DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chil-4

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_496125.1 Gene:chil-4 WormBaseID:WBGene00007469 Length:457 Species:Caenorhabditis elegans

Alignment Length:453 Identity:87/454 (19%)
Similarity:166/454 (37%) Gaps:139/454 (31%)


  Fly    29 KHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYA---------GIERDSHKAVSLNQQL 84
            |.:|.|:  |.|....|.:       ..||...:::|.:|         |.||...|...:..: 
 Worm   110 KRIVGYF--AEFENTALTR-------KQLQMLTHIIYLFAIPKNGNMTFGGERSRRKFEEMKNE- 164

  Fly    85 DLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVY 149
                          .::....:|:::|:||..:          ...:..|:.:.|.|..|||::.
 Worm   165 --------------ARKANSTLKVMISIGGQSN----------SRSFSRLVSNETSRNVFVNSIV 205

  Fly   150 SLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVK 214
            |.|:.|..||:::.|.:||                               .|....:...:::::
 Worm   206 SFVQKYDIDGIEIFWTWPK-------------------------------YEDANNYLIFIQELR 239

  Fly   215 NAF--------RPDNLLLSTTVLPNVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQRNPEVADYAA 271
            .||        |.::.::|  ::.|...:...::.....::||.|:.:..:.:.|..|     ::
 Worm   240 YAFIELQKKLNRKEDYVIS--IIVNCYDNQLSNLMGFSKFVDFFNIYSIHYQSRQVGP-----SS 297

  Fly   272 PIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWK-----LTDDSGDTGVPPVKDVK 331
            |:|....|    |:...:||::......||.|:.|..:|..||     |.:||.|.       .|
 Worm   298 PLYGGGSR----NIDETMKYYICRTGQPSKFNMMVLFHGTFWKGAELPLRNDSDDI-------FK 351

  Fly   332 DEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGDNGI 396
            |:....|...|    .|.|:.....:.:|          ||..:..|.  ||.:...     :.:
 Worm   352 DQNSAKGGFAV----RWRELLQQKWDMSN----------IKFHNLTKT--SYMWIPG-----SSL 395

  Fly   397 WVSFEDPDTAADKAGYVRTENLGGVALFDLSYDD----------FRGLCTNEKYPILRAIKYR 449
            :::.||..:...|..||...|:||:.::.:..||          ...|||.::   ...||::
 Worm   396 FLTLEDEQSLRVKNRYVADHNIGGITMWTIDQDDGDHTLLKVVSSAELCTGDE---KNTIKFK 455

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 86/453 (19%)
Glyco_18 31..429 CDD:214753 79/420 (19%)
chil-4NP_496125.1 Glyco_18 111..428 CDD:214753 79/421 (19%)
GH18_chitinase-like 112..428 CDD:299167 79/420 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66317414
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.790

Return to query results.
Submit another query.