DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chil-2

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_496133.2 Gene:chil-2 WormBaseID:WBGene00007466 Length:383 Species:Caenorhabditis elegans

Alignment Length:380 Identity:78/381 (20%)
Similarity:149/381 (39%) Gaps:119/381 (31%)


  Fly    98 RLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDV 162
            :.|...||:||::.:.|               |:..:|.....:..|:.::.|.|..:.|||:|:
 Worm    89 KAKMDNPNLKIMVEING---------------KFFSVLAEDEKKNSFIKSISSFVVDHKFDGVDI 138

  Fly   163 AWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPDNLLLSTT 227
            .|.:|:::         ..:..|.|.|.      ||.|:|                    ::.:.
 Worm   139 FWSWPEDE---------DTFHLFIKEFR------EKLEKH--------------------MIISI 168

  Fly   228 VLPNVNSSL-FYDIPAVVNYLDFVNLGTFDFFTPQRNPEVADYAAPIYEL--SERNPEFNVAAQV 289
            .:|.:...| .:::..::|::||:|:.:.:::.|.  |.......||..|  .:|.   ||...:
 Worm   169 AIPRLAQQLEGFNLKLLMNHIDFLNVLSINYYEPL--PGNGANIGPISPLYGGQRG---NVDGTL 228

  Fly   290 KYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCAL 354
            ||........|.:|:||...|..|              ..|||           |:....::..:
 Worm   229 KYLTCITKRPSILNMGVTFTGIFW--------------NGVKD-----------GLNEQDDIWKV 268

  Fly   355 LPNQN--------NAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAG 411
            ..|:|        ..::|.....:.:..|.:|  .|||:....|     |:::||:..:.::|..
 Worm   269 AQNENGPGKSIGWRKFIKDRRNTIPQWHDSSK--SSYAWDPKSK-----IFLAFENEKSLSEKVI 326

  Fly   412 YVRTENLGGVALFDLSYDDFRGLCTNEKYPILRAI--------------KYRLTN 452
            |||.:|:||:.::::..||      |:. .:|.|:              |||.:|
 Worm   327 YVRNKNIGGLVIWNVDQDD------NDN-SLLNALTSMDMCARGSGGTMKYRCSN 374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 77/377 (20%)
Glyco_18 31..429 CDD:214753 69/342 (20%)
chil-2NP_496133.2 Glyco_18 42..344 CDD:214753 69/342 (20%)
GH18_chitinase-like <88..344 CDD:299167 69/342 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66317594
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.790

Return to query results.
Submit another query.