DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chil-1

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001040740.1 Gene:chil-1 WormBaseID:WBGene00007465 Length:465 Species:Caenorhabditis elegans

Alignment Length:444 Identity:90/445 (20%)
Similarity:171/445 (38%) Gaps:122/445 (27%)


  Fly    29 KHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERDSHKAVSLNQQLDLDLGKGLY 93
            |.:|.|:  |.|...||.:       ..||...:::|.:| |.|:....:..::.|     :...
 Worm   117 KRIVGYF--AEFENSGLTR-------KQLQMLTHIIYLFA-IPRNGVITIVDDRSL-----RKFE 166

  Fly    94 RTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFD 158
            ...:..:.....:||::|:||..:          ...:..|:.:.|.||.|||::.|.|:.|..|
 Worm   167 EMKSNAREASSTLKIMISIGGHYN----------SRSFSGLVFNETSRTVFVNSIVSFVEKYDID 221

  Fly   159 GLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAF------ 217
            |:::.|.:|:.:                               .|..:...:::::.||      
 Worm   222 GIEMFWMWPRYR-------------------------------DKNNYLMFIQELRYAFTELQNK 255

  Fly   218 --RPDNLLLSTTVLPNVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQRNPEVADYAAPIYELSERN 280
              |.::.::|.....|:|  |.:::...:|.:||..:..|:.::.|..|:     :|:|....| 
 Worm   256 LNRKEDFVISLVASSNLN--LLFNLVEFLNSVDFFGIYLFNSYSYQVGPD-----SPLYGGGSR- 312

  Fly   281 PEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVKDVKDEA-PVGGNTQVPG 344
               ||...:||::......||.|:.::.:...|:.||       .|::|..|.. .|..:.::..
 Worm   313 ---NVDEIMKYYICKTGQPSKFNIIISFHATYWEGTD-------LPLRDDSDNIWKVNESGRLAV 367

  Fly   345 IYSWPEVCALLPN-----QNNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPD 404
            ...|.|    ||:     :|..:........|.:..|..||                 ::.||..
 Worm   368 ALRWRE----LPHHKWNLENIKFHNLTKTSYIWIPGPPTRF-----------------LTLEDEQ 411

  Fly   405 TAADKAGYVRTENLGGVALFDLSYDD----------FRGLCTNEKYPILRAIKY 448
            :..:|..||...|:||:.::.:..||          ...|||.|:   ...|||
 Worm   412 SLREKNRYVADHNIGGITMWTIDQDDDDHTLLKVVSSAELCTGEE---KNTIKY 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 89/444 (20%)
Glyco_18 31..429 CDD:214753 80/412 (19%)
chil-1NP_001040740.1 Glyco_18 118..436 CDD:214753 80/413 (19%)
GH18_chitinase-like 119..436 CDD:299167 80/412 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66317380
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.