DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and cht-1

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_508588.1 Gene:cht-1 WormBaseID:WBGene00000503 Length:617 Species:Caenorhabditis elegans

Alignment Length:440 Identity:112/441 (25%)
Similarity:186/441 (42%) Gaps:95/441 (22%)


  Fly    33 CYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERDSHKAVSLNQQLDLD---LGKGLYR 94
            ||:.:.:..::|..|.|.::..|.|  |.::::.:..:..|  ..|......||.   .|:|:||
 Worm    57 CYFTNWAQYRQGRAKFVPEDYTPGL--CTHILFAFGWMNAD--YTVRAYDPADLPNDWAGEGMYR 117

  Fly    95 TVTRLKRKYPNVKILLSVGG-DKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFD 158
            .|.:||.....:|.|||.|| .....|          :..:..|...|..|:::..:.|:|:|||
 Worm   118 RVNKLKVTDTQLKTLLSFGGWSFGTAL----------FQGMAASSASRKVFIDSAITFVRTWGFD 172

  Fly   159 GLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFR----- 218
            |:|:.|::|        ||...:                      ..:.||::::|.|..     
 Worm   173 GIDIDWEYP--------SGATDM----------------------ANYVALVKELKAACESEAGS 207

  Fly   219 --PDNLLLSTTVLPN-VNSSLFYDIPAVVNYLDFVNLGTFDFFTPQRNPEVADYAAPIYELSERN 280
              .|.||::..|... ......||||.:....||:.|.::|||....:  :..:.:|:|..:|..
 Worm   208 TGKDRLLVTAAVAAGPATIDAGYDIPNLAPNFDFILLMSYDFFGAWAS--LVGFNSPLYATTELP 270

  Fly   281 PE---FNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDS----GDTGVPPVKDVKDEAPVGG 338
            .|   :||.:..:||.:...|..||.||:.||||.|.|.:.|    |.:|.|        |.:..
 Worm   271 AEWNGWNVDSSARYWNQKGMPKEKIIVGMPTYGRGWTLNNASAINPGTSGSP--------AKITQ 327

  Fly   339 NTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDP 403
            ..|..|:.::.|.|.:|.|....|....:.....||                 |:.  |.|::|.
 Worm   328 YVQEAGVGAYFEFCEMLANGATRYWDSQSQVPYLVQ-----------------GNQ--WWSYDDE 373

  Fly   404 DTAADKAGYVRTENLGGVALFDLSYDDFRGLCTN---EKYPILRAIKYRL 450
            ::.|:|..||:.|..||..::.|.:|||...|:|   :.||::..|...|
 Worm   374 ESFANKMAYVKREGYGGAFVWTLDFDDFNAGCSNSNGQLYPLISVIAKEL 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 111/439 (25%)
Glyco_18 31..429 CDD:214753 103/415 (25%)
cht-1NP_508588.1 GH18_chitolectin_chitotriosidase 55..423 CDD:119351 111/439 (25%)
Glyco_18 57..399 CDD:214753 103/415 (25%)
CBM_14 481..532 CDD:279884
CBM_14 567..615 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.