DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and lmd-4

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_504862.2 Gene:lmd-4 WormBaseID:WBGene00017233 Length:2011 Species:Caenorhabditis elegans

Alignment Length:467 Identity:104/468 (22%)
Similarity:180/468 (38%) Gaps:124/468 (26%)


  Fly    19 SKV----GAPQLPK----KHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERDSH 75
            |||    |...||.    |.:|.||       .|.|...|.|.:  |:...::::.:..:..|. 
 Worm  1461 SKVEEPTGKSSLPAASCGKRIVGYY-------TGWGDREITENQ--LKKLTHVIFAFVAMYEDG- 1515

  Fly    76 KAVSLNQQLDLDLG----KGLYRTVTRLKRK----YPNVKILLSVGGDKDIELDKDAKELPNKYL 132
             :|......:.|.|    |...|....:|:|    ...|::|.:|||..:           ::|.
 Worm  1516 -SVKFGAVSEDDSGPQAAKKAERRFLNMKKKARAANSGVRVLFAVGGWDN-----------SQYF 1568

  Fly   133 ELLESPTG-RTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVD 196
            ..:.:.:| |.:||:::.|.|:....||:|:.|::|.:..|...:.: .|.|..::.||..:   
 Worm  1569 SSVAADSGKRKKFVDSIASFVEDQKIDGVDLDWEYPDSNGKDAKNHV-QLIKEIREKFSEMA--- 1629

  Fly   197 EKSEEHKEQFTALLRDVKNAFRPDNLLLSTTVLPNVNSSLFYDIPAVVNYLDFVNLGTFDFF--- 258
             |.::.|:.:...|......:               |....||:..::.|.||:|:.|:|::   
 Worm  1630 -KKKKRKDPYVITLASAAGEW---------------NLRKGYDLKGILKYADFINVMTYDYYGAW 1678

  Fly   259 ---------TPQRNPEVADYAAPIY--ELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRP 312
                     ||          ||:|  .|...:.:.|....:|::.......|::|:||..|||.
 Worm  1679 ESKWGAYTGTP----------APLYFGSLKGFSGKLNADFSMKFYACKTEKPSQLNMGVPFYGRY 1733

  Fly   313 WKLTDDSGDTGVPPVKDVKDE-----APVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIK 372
            ||       ..:.|: |..|.     ||..|..: .|...|..:.      ...:.||:.:...|
 Worm  1734 WK-------NVLGPI-DKSDNMWRTAAPQNGKYE-GGYVGWRNLA------KEGWNKGSASWHEK 1783

  Fly   373 VQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDD------- 430
            .:.|      |......||     ::.||:..:..:|..|....||||:.::.|..||       
 Worm  1784 TKTP------YIMNNGAKK-----FLGFENERSLKEKMKYATDRNLGGLMIWALDLDDDADTLLN 1837

  Fly   431 ---FRGLCTNEK 439
               ..|||:..|
 Worm  1838 LVSSAGLCSGGK 1849

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 97/449 (22%)
Glyco_18 31..429 CDD:214753 91/426 (21%)
lmd-4NP_504862.2 LysM 25..65 CDD:197609
LysM 79..120 CDD:197609
LysM 142..185 CDD:197609
LysM 209..250 CDD:197609
LysM 270..313 CDD:197609
LysM 334..377 CDD:197609
LysM 401..444 CDD:197609
LysM 469..509 CDD:197609
LysM 550..590 CDD:197609
LysM 635..678 CDD:197609
LysM 710..750 CDD:197609
LysM 760..802 CDD:197609
LysM 876..919 CDD:197609
Self-incomp_S1 1359..1433 CDD:283566
Glyco_18 1480..1825 CDD:214753 90/423 (21%)
GH18_chitinase-like 1481..1824 CDD:299167 90/421 (21%)
ChtBD1_GH18_2 1873..1924 CDD:211315
ChtBD1_GH18_2 1951..2002 CDD:211315
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66317687
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.790

Return to query results.
Submit another query.