DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and cht-3

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_501082.2 Gene:cht-3 WormBaseID:WBGene00016084 Length:1067 Species:Caenorhabditis elegans

Alignment Length:429 Identity:90/430 (21%)
Similarity:142/430 (33%) Gaps:152/430 (35%)


  Fly    60 CDYLVYGYAGIERDS----HKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIEL 120
            |.:||||...|:||:    :....:....|:|    ..||..||::.:||.|:|:.|...|..| 
 Worm    51 CTHLVYGSIPIDRDTGYPQYSVSDVESGYDID----NIRTFMRLRKYHPNAKLLMGVVRTKPFE- 110

  Fly   121 DKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQ---------------FPKNK 170
              ||              ....:..|.:.|.||:..||||.|.:.               ..|:|
 Worm   111 --DA--------------ATSVKVANGLRSHVKSKRFDGLFVTFNGIHLEYRASTSFLETISKDK 159

  Fly   171 PKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPDNLLLSTTVLPNVNSS 235
            ...:..|:..     ::||:               |.||.|                 |..:|..
 Worm   160 KMSLTFGVTG-----RRVFA---------------FDALRR-----------------LQEINDL 187

  Fly   236 LFYDIPAVVNYLDFVNLGTFDFFTPQRNPEVADYAAPIYELSERNPEF---------NVAAQVKY 291
            :.|      .|||...|.:        |.|:|       .::..||.|         .:...|:.
 Worm   188 VEY------IYLDMGELPS--------NEELA-------RVTHINPLFYNGSIPFEETIQGTVEE 231

  Fly   292 WLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLP 356
            ..:.....|:|.||:...|  ||.             ::|:       ||.|           |.
 Worm   232 LSKEGILPSRIVVGLTAGG--WKF-------------EIKE-------TQDP-----------LK 263

  Fly   357 NQNNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGDNGI------WVSFEDPDTAA--DKAGYV 413
            ..:..|.:. |...:..||..:..|:..|   |.:..|.|      |:|...|...|  :|..::
 Worm   264 ISHGQYAEN-NGKRVSYQDACRARGAVIY---DWQTMNEITVYRQTWMSVNLPTIKAMGEKMKWI 324

  Fly   414 RTENLGGVALFDLSYDDFRGLCTNEKYPILRAIKYRLTN 452
            ..:...|:.:....:||.||.|..:..|..|.:...:.|
 Worm   325 LGQKFAGIGISHALFDDPRGDCGTDPLPAHRLVMELIRN 363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 89/426 (21%)
Glyco_18 31..429 CDD:214753 82/405 (20%)
cht-3NP_501082.2 Glyco_18 51..334 CDD:214753 82/399 (21%)
GH18_chitinase-like 51..>103 CDD:299167 18/56 (32%)
Glyco_18 375..702 CDD:214753
GH18_chitinase-like 387..723 CDD:299167
Glyco_hydro_18 761..1043 CDD:279094
GH18_chitinase-like <1018..1062 CDD:299167
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.