DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chil-8

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_496132.1 Gene:chil-8 WormBaseID:WBGene00007473 Length:399 Species:Caenorhabditis elegans

Alignment Length:491 Identity:100/492 (20%)
Similarity:183/492 (37%) Gaps:160/492 (33%)


  Fly     1 MIIKALAIVSLCLASI------QASKVGAPQ-LPKKHLVCYYDSASFVKEGLGKLVIDELEPALQ 58
            :::....|||..::|:      .::.|.:|. |.:|.::.|..|    .|| .::.|.:||....
 Worm    13 VLLFVFGIVSFLVSSLFCYFYDFSNSVQSPSVLHRKRIIGYVSS----DEG-SEITIKQLEKLTH 72

  Fly    59 --FCDYLVY-------------GYAGIERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKI 108
              |...||:             |:..::|.|           ::|.:||              |:
 Worm    73 VIFAFILVHKDGTIKFKYGTKDGFFDMKRKS-----------MELNRGL--------------KV 112

  Fly   109 LLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKK 173
            ::|:||.:...|..|.  |..|..:|:.|          :..|||.:..||:|:.|.:|      
 Worm   113 MVSIGGYESSPLFSDV--LVKKKKKLIAS----------IALLVKKFDLDGVDIFWNWP------ 159

  Fly   174 VHSGIGSLWKGFKKVFSGDSIVDEKS-----EEHKEQFTALLRDVKNAFRPDNLLLSTTVLPNVN 233
                               ||.|:.:     .|.:::.|    ::|:.....|..:.:.:.|:.:
 Worm   160 -------------------SITDQSNYLIFIRELRKKLT----NLKDENGRSNEYVISVIAPSSS 201

  Fly   234 SSLFYDI--PAVVNYLDFVNLGTFDFFTPQRNPEVADYAAPIYELSERNPEF--------NVAAQ 288
            |...|..  ..::..:||:|:.||::|               ||.::..|..        ||...
 Worm   202 SHSEYPYKWTEILENVDFINVITFEYF---------------YEANKIGPHSPLYGGSFGNVDDT 251

  Fly   289 VKYWLRNNCPASKINVGVATYGRPWKLT----DDSGDTGVPPVKDVKDEAPVGGNTQVPGIYSWP 349
            :||.:......:|:|:.|:..|..|..|    ||.| ..:|      |::..|     |..|.|.
 Worm   252 LKYLICRTRTPNKLNMVVSFNGIYWGNTTLPFDDKG-VWIP------DDSAQG-----PYSYGWK 304

  Fly   350 EVCALLP--NQNN-AYLKGANAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAG 411
            :...:..  :||: .:.:....|.|                  .|.|...:::||:..:..:|..
 Worm   305 QFARMSHGFDQNDFEWNEETRTPYI------------------WKADTQQFLTFENEKSLTEKMN 351

  Fly   412 YVRTENLGGVALFDLSYDDFRGLCTNEKYPILRAIK 447
            |....|:||||::.:..||......|.....|.::|
 Worm   352 YAVAHNIGGVAMYTIDDDDEENTLLNVVVTNLPSLK 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 92/456 (20%)
Glyco_18 31..429 CDD:214753 87/435 (20%)
chil-8NP_496132.1 Glyco_18 49..369 CDD:214753 87/436 (20%)
GH18_chitinase-like 50..369 CDD:299167 87/435 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66317524
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.790

Return to query results.
Submit another query.