DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chil-21

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_496029.2 Gene:chil-21 WormBaseID:WBGene00011164 Length:470 Species:Caenorhabditis elegans

Alignment Length:469 Identity:99/470 (21%)
Similarity:180/470 (38%) Gaps:122/470 (26%)


  Fly     5 ALAIVSLCLASIQ--ASKVGAPQLP-----KKHLVCYY---DSASFVKEGLGKLVIDELEPALQF 59
            |....|.|..::.  :|.|.|...|     .|.::.||   .::...::.:.||.          
 Worm    78 ASGFFSECTPTVTSISSTVAASTYPATPGCNKRIIGYYFATQTSVITRDQVSKLT---------- 132

  Fly    60 CDYLVYGYAGIERDSHKAVSLNQQLDLDLGKGLYRTVTRL-KRKYPNVKILLSVGGDKDIELDKD 123
              :.|:.:..:..|.|      .|:|.||.|..:..:..: |::.|.||:::|:||:.:      
 Worm   133 --HAVFAFVNMTSDGH------LQIDGDLAKNRFTNLIEIAKQQTPQVKVMISIGGNDN------ 183

  Fly   124 AKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKV 188
                .|.:..:|.||..:..|:|:..|.::||..||:|:.|::|....|.::|            
 Worm   184 ----SNNFKPVLSSPDRKKLFINSTVSFLQTYDIDGVDLYWKWPGKTSKDIYS------------ 232

  Fly   189 FSGDSIVDEKSEEHKEQFTALLRDVKNAFRPD--NLLLSTTVLP---NVNSSLFYDIPAVVNYLD 248
                            ||   :.|::.:.:..  |.::|..:.|   ..|.....||..:.:.:|
 Worm   233 ----------------QF---INDLRYSLQRQKRNYIMSIVLPPPDMGANYEAGIDIENIFDNVD 278

  Fly   249 FVNLGTFDFFTPQRNPE--VADYAAPIYELSERNP---EFNVAAQVKYWLRNNCPASKINVGVAT 308
            |:|:.|..:|.|.:|..  :...|:.::......|   .:|:....:.::.....:.|.|:.:..
 Worm   279 FLNIFTMGYFGPWQNDAGMITGAASQLFNGVNGVPGRKTYNIHHSTERYVCKTGQSDKYNIAIPF 343

  Fly   309 YGRPWKLTDDSGDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIK- 372
            |...||..  .|....|.::..::....||                        :.|..:...| 
 Worm   344 YTMLWKHV--KGPVNPPNIEIYRNATFQGG------------------------VVGETSMSRKL 382

  Fly   373 VQDPAKRFGSYAY----RAADK-KGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDD-- 430
            ||:....|.:..|    |||.| ......:::||..||.|.|..||:...||||.::.:..||  
 Worm   383 VQEEGYDFSNPTYNPEIRAAFKYNATTETFLTFETNDTIAAKIDYVKDRILGGVWIWAVDMDDDS 447

  Fly   431 --------FRGLCT 436
                    |.|.||
 Worm   448 NNLLNLVKFTGYCT 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 91/438 (21%)
Glyco_18 31..429 CDD:214753 85/418 (20%)
chil-21NP_496029.2 Glyco_18 110..444 CDD:214753 85/419 (20%)
GH18_chitinase-like 132..460 CDD:299167 85/413 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66317830
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.