DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chil-13

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_496018.2 Gene:chil-13 WormBaseID:WBGene00010945 Length:439 Species:Caenorhabditis elegans

Alignment Length:427 Identity:90/428 (21%)
Similarity:164/428 (38%) Gaps:105/428 (25%)


  Fly    23 APQLP--KKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERDSHKAVSLNQQLD 85
            :|:.|  |:.:|.|:......:  :.|..||:|..|       |:.:..|:.|.        .|.
 Worm    72 SPKKPVCKRRIVGYFSEIESTE--ISKSQIDKLTHA-------VFAFVRIKYDG--------TLQ 119

  Fly    86 LDLGKGLYR-TVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVY 149
            .|..|...| ::.:.|.:..||::::|:||         ..|..:.:...|.....:..|::::.
 Worm   120 FDNSKADLRFSILKDKTRGSNVEMMVSIGG---------GYENAHYFASALSDSQKKKNFIDSIL 175

  Fly   150 SLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDE---KSEEHKEQFTALLR 211
            :.:..:..||:|..||                |...:..|:..:.:.|   |.:|:|.:      
 Worm   176 AFLVEHRIDGVDFFWQ----------------WPTVQDTFNYVTFIRELRQKLDENKRK------ 218

  Fly   212 DVKNAFRPDNLLLSTTVLPNV---NSSLFYDIPAVVNYLDFVNLGTFDFFTPQRNPEVADYAAP- 272
                     :.|:|.|| |..   |..|.:|:..:.|::||.|:.:.|:..|..|    .:..| 
 Worm   219 ---------HFLISMTV-PAAGVDNWELGFDLEELQNHVDFFNVYSMDYAGPWPN----QWGVPT 269

  Fly   273 ------IYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGD--TGVPPVKD 329
                  .|.:..|. .|.|...:|::.......|.:|:.:....|.|....::.|  |.|....:
 Worm   270 GPSSPMFYNIGARK-NFYVDWTMKHYTCKLKQPSMLNMVIPFSARIWNNVQEAIDNRTEVFRNAE 333

  Fly   330 VKDEAPVGGNTQVPGIYSWPEVCALLPNQ-NNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGD 393
            :|:.. ..|.||:....:..|...|.|:. :|..:    .|.| :...||.|             
 Worm   334 LKNNM-AEGRTQISRWTAEHEGLELSPSSWDNLTM----TPYI-LDLKAKTF------------- 379

  Fly   394 NGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDD 430
                ::|||..:...|..|.:..:||||.|:.:..||
 Worm   380 ----LTFEDKRSIKIKTDYAKKMDLGGVWLWSVDMDD 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 87/419 (21%)
Glyco_18 31..429 CDD:214753 85/415 (20%)
chil-13NP_496018.2 Glyco_18 81..411 CDD:214753 85/416 (20%)
GH18_chitinase-like 82..411 CDD:299167 85/415 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66318102
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.790

Return to query results.
Submit another query.