DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and cht-2

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_495798.2 Gene:cht-2 WormBaseID:WBGene00011757 Length:626 Species:Caenorhabditis elegans

Alignment Length:403 Identity:89/404 (22%)
Similarity:164/404 (41%) Gaps:101/404 (25%)


  Fly    62 YLVYGYAGIERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKE 126
            :||:.:..::.|.      :.:|:.|..|.....|..:..::|::|:|.:|||.::         
 Worm    56 HLVFAFFVVDSDG------SVKLEGDAAKARLEHVKEVASRHPDLKLLYAVGGWEN--------- 105

  Fly   127 LPNKYLELLESP-TGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFS 190
              ::|..:|.:. :.|:..::....::|.|||||:|:.|::|                     .:
 Worm   106 --SQYFSVLTADHSRRSILISNFVKVIKEYGFDGVDIDWEYP---------------------VT 147

  Fly   191 GDSIVDEKSEEHKEQFTALLRDVKNAFRP------DNLLLS-------TTVLPNVNSSLFYDIPA 242
            |.::  |.:...:..:..|:|:::|..|.      .:.|:|       ..:.|.      ||:..
 Worm   148 GGAV--EGTPADRRNYVNLMRELRNELRDLESETGKSYLISFAGAAGHWVLKPG------YDLQQ 204

  Fly   243 VVNYLDFVNLGTFDFFTPQRNPEVADYAAPIYELSERNPE-----FNVAAQVKYWLRNNCPASKI 302
            ::.|.||||:.::|:|....:...| |..|...|....|:     .||.|.:|.:........||
 Worm   205 LMKYCDFVNVMSYDYFGAWASKWGA-YTGPPAPLQFAMPKKFSGRMNVHATMKDYSCQIKATDKI 268

  Fly   303 NVGVATYGRPWK-------LTDDSGDTGVPPVKD-VKDEAPVGGNTQVPGIYSWPEVCALLPNQN 359
            |:||..|||.||       .|||...|......: .|.|   ||:.|      |.::........
 Worm   269 NMGVPFYGRFWKNVGDAVDSTDDMWRTATATNSEGTKFE---GGDVQ------WRDLHEKFDTTK 324

  Fly   360 NAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALF 424
            ..:..|:..|.|.:.: .|.|                 |.:|:.::...|..|:...|:|||.::
 Worm   325 TKFHSGSKTPFIWLSE-QKTF-----------------VGYENAESLKHKVDYIVENNIGGVMIW 371

  Fly   425 DLSYDDFRGLCTN 437
            .:.:||.:|...|
 Worm   372 AIDFDDDQGTLLN 384

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 89/404 (22%)
Glyco_18 31..429 CDD:214753 85/394 (22%)
cht-2NP_495798.2 Glyco_18 33..376 CDD:214753 85/394 (22%)
GH18_chitinase-like 35..376 CDD:299167 85/394 (22%)
ChtBD1_GH18_2 418..469 CDD:211315
ChtBD1_GH18_2 496..547 CDD:211315
ChtBD1_GH18_2 567..618 CDD:211315
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.860

Return to query results.
Submit another query.