DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and btb-16

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_494499.2 Gene:btb-16 WormBaseID:WBGene00018195 Length:304 Species:Caenorhabditis elegans

Alignment Length:184 Identity:36/185 (19%)
Similarity:71/185 (38%) Gaps:46/185 (25%)


  Fly   120 LDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAW--QFPKNKPKKVHSGIGSLW 182
            ::.::|::|.:...::....|.|        ::.|...:||...|  :...|     :|.|...|
 Worm     6 IEYESKKVPLRGPHMMSGQGGTT--------VLDTSTTNGLKCTWSGEIVNN-----NSQICFTW 57

  Fly   183 KGFKKVFSGDSIVDE-------KSEEHKEQFTALLRDVKNAFRPDNLLLSTTVLPNVNS----SL 236
            | |:...:|:..:|:       |..:::.|....:|.:.:...|...|  |.|:.|.|.    .:
 Worm    58 K-FEYDEAGNEDIDKIAGAIDVKFGQNQSQNFTTVRTLVSLTEPCQTL--TKVVENPNRQGAVEV 119

  Fly   237 FYDIPAVVNYLDFVNLGTFDFFTPQRNPEVADYAAPIYELSERNPEFNVAAQVK 290
            .|:. |:|.::..:.....:.|.|                ||:|..|.|..:.|
 Worm   120 MYEY-ALVPWITPLQFSFDEMFLP----------------SEKNDAFLVIGERK 156

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 36/185 (19%)
Glyco_18 31..429 CDD:214753 36/185 (19%)
btb-16NP_494499.2 BTB 136..240 CDD:279045 8/38 (21%)
BTB 147..243 CDD:197585 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.