DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and btb-17

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_872000.1 Gene:btb-17 WormBaseID:WBGene00018200 Length:321 Species:Caenorhabditis elegans

Alignment Length:185 Identity:45/186 (24%)
Similarity:66/186 (35%) Gaps:52/186 (28%)


  Fly   293 LRNNCPASKINVGVATYGRPWKLT-DDSGDTGVPPVK---DVKDEA-------PVGGN---TQVP 343
            :.||   |:||.       .||.. |::|:..:..:.   |||...       ..|.|   |.|.
 Worm    55 VNNN---SQINF-------TWKFEYDEAGNEDIDEIAGTIDVKFRRNQVSGMFQTGQNQNFTTVH 109

  Fly   344 GIYSWPEVCALL------PNQNNA----YLKGANAPLIKVQDPAKRFGSYAYRAADKKGD----- 393
            .:.|..|.|..|      |||..|    |:. |..|.|   :|. :|.......:.||.|     
 Worm   110 TLVSLTEHCQTLTKLVEVPNQPGAVEVMYVY-ALVPWI---NPL-QFSFDEMFLSSKKNDAVLVI 169

  Fly   394 -------NGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRGLCTNEKYP 441
                   |..::|:......|..:...:.:....:.|.|:.|:|| ||.....||
 Worm   170 GERKLHVNKAFLSYHSDYFRALFSSNFKEDKQDEIELKDVVYEDF-GLLMTTIYP 223

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 45/186 (24%)
Glyco_18 31..429 CDD:214753 39/172 (23%)
btb-17NP_872000.1 BTB 153..257 CDD:279045 15/73 (21%)
BTB 164..260 CDD:197585 13/62 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.