DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and chil-24

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_494455.1 Gene:chil-24 WormBaseID:WBGene00020407 Length:410 Species:Caenorhabditis elegans

Alignment Length:469 Identity:93/470 (20%)
Similarity:174/470 (37%) Gaps:135/470 (29%)


  Fly    28 KKH---------LVCYY-----DSASFVKEGLGKLVIDELE--PALQFCDYLVYGYAGIER---D 73
            |||         .||.:     ||..|......|:..:|.|  |:     .:|..||..||   .
 Worm    10 KKHRRSEETQRWKVCRHCHEKQDSTFFSIHSNYKMSNNETETTPS-----RIVGFYADWERTDIT 69

  Fly    74 SHKAVSLNQ------QLDLDLGKGLYRTVTRL----------KRKYPNVKILLSVGGDKDIELDK 122
            ||:...|..      |:..|...|......|:          :.:..|||:::|:||.::.:   
 Worm    70 SHQVAKLTHAVFAYVQMKFDGSLGFKNDAARIRFSNLRDKVRRNEDSNVKMMISIGGFENSQ--- 131

  Fly   123 DAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKK 187
                   .:..:|.:...:..|:|::.|.:..:...|:|:.|::|                    
 Worm   132 -------HFYPVLSNVEMKKAFLNSISSFLAYHELHGVDIFWKWP-------------------- 169

  Fly   188 VFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPDNLLLSTTVLPNV---NSSLFYDIPAVVNYLDF 249
                       |.|.|..::..|.|::.....:.::  :..:|..   |..|.||:..:.:::||
 Worm   170 -----------SPEDKAHYSRFLADLRQHLGYEFII--SVAVPQAEVSNLELGYDLRTISSHVDF 221

  Fly   250 VNLGTFDFFTPQRNP--EVADYAAPIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRP 312
            .|:.:.|::.|..|.  :.....:|:|..:..|.::.    ::|:........|:|:.:..:.|.
 Worm   222 FNVHSMDYYGPWPNEWGKPTGPISPLYGPTRHNVDWT----LRYYAEKTGEPGKLNMVIPFFVRL 282

  Fly   313 WKLTDDSGDTGVPPVKDVK--DEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQ- 374
            ||...:..:.|....:||:  |..|                      |..||:...:|...::. 
 Worm   283 WKNVPEPVEPGRQVFRDVELVDNKP----------------------QGEAYMSRWSAQHEELDL 325

  Fly   375 DPA----KRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGV---------ALFDL 426
            .||    :...||.:..     |...:|:||...:..:|..||:.:|||||         .|.|.
 Worm   326 SPADWDEETRSSYTWNP-----DTRNFVTFETDKSIQEKMKYVKEKNLGGVWIWHVDANEKLLDS 385

  Fly   427 SYDDFRGLCTNEKY 440
            ...|..|:..:::|
 Worm   386 VRFDGEGVVDDQEY 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 91/468 (19%)
Glyco_18 31..429 CDD:214753 87/445 (20%)
chil-24NP_494455.1 Glyco_18 55..378 CDD:214753 76/397 (19%)
GH18_chitinase-like 56..378 CDD:299167 76/396 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66317761
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.790

Return to query results.
Submit another query.