DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and CTBS

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_004379.1 Gene:CTBS HGNCID:2496 Length:385 Species:Homo sapiens

Alignment Length:344 Identity:59/345 (17%)
Similarity:117/345 (34%) Gaps:117/345 (34%)


  Fly   138 PTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEH 202
            |..|..::....:|.||...||:::          .:...:..|                 |.|:
Human   116 PAFRASWIAQKLNLAKTQYMDGINI----------DIEQEVNCL-----------------SPEY 153

  Fly   203 KEQFTALLRDVKNAFRPD----NLLLSTTVLPNVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQRN 263
             :..|||:::..::|..:    .:.......|.......|:...:.:..||:.:.::|       
Human   154 -DALTALVKETTDSFHREIEGSQVTFDVAWSPKNIDRRCYNYTGIADACDFLFVMSYD------- 210

  Fly   264 PEVADYAAPIYELSERNPEFNVAAQVKY---------WLRNNCPASKINVGVATYGRPW---KLT 316
                       |.|:...|...||...|         :::.:....|:.:||..||..:   .|:
Human   211 -----------EQSQIWSECIAAANAPYNQTLTGYNDYIKMSINPKKLVMGVPWYGYDYTCLNLS 264

  Fly   317 DDSGDT-------GVP---------PVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKG 365
            :|...|       |.|         |.|.:..:.    |:.:.|               |.:.|.
Human   265 EDHVCTIAKVPFRGAPCSDAAGRQVPYKTIMKQI----NSSISG---------------NLWDKD 310

  Fly   366 ANAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDD 430
            ..||....:|||..|             :.:|  :::|.:.:.||.|::...|.|:.:::.:..|
Human   311 QRAPYYNYKDPAGHF-------------HQVW--YDNPQSISLKATYIQNYRLRGIGMWNANCLD 360

  Fly   431 FRGLC-----TNEKYPILR 444
            :.|..     |.|.:.:|:
Human   361 YSGDAVAKQQTEEMWEVLK 379

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 59/345 (17%)
Glyco_18 31..429 CDD:214753 54/323 (17%)
CTBSNP_004379.1 GH18_chitobiase 39..378 CDD:119354 58/342 (17%)
Glyco_18 <115..358 CDD:214753 54/322 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.