| Sequence 1: | NP_001286499.1 | Gene: | Idgf6 / 36868 | FlyBaseID: | FBgn0013763 | Length: | 452 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001254213.1 | Gene: | T19H5.6 / 13186491 | WormBaseID: | WBGene00044807 | Length: | 286 | Species: | Caenorhabditis elegans | 
| Alignment Length: | 262 | Identity: | 54/262 - (20%) | 
|---|---|---|---|
| Similarity: | 108/262 - (41%) | Gaps: | 67/262 - (25%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     1 MIIKALAIVSLCLASIQASKV----GAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCD 61 
  Fly    62 YLVYGYAGIERDSHKAVSLNQQLDLDLGKGLYRTVTRL-KRKYPNVKILLSVGGDKDIELDKDAK 125 
  Fly   126 ELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFS 190 
  Fly   191 GDSIVDEKSEEHKEQFTALLRDVKNAF--RPDNLLLSTTVLP-NVN--SSLFYDIPAVVNYLDFV 250 
  Fly   251 NL 252 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Idgf6 | NP_001286499.1 | GH18_IDGF | 30..450 | CDD:119352 | 44/229 (19%) | 
| Glyco_18 | 31..429 | CDD:214753 | 44/228 (19%) | ||
| T19H5.6 | NP_001254213.1 | Glyco_18 | 69..>255 | CDD:214753 | 44/229 (19%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C160164415 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG3325 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| 4 | 3.700 | |||||