DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Ovgp1

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_031722.1 Gene:Ovgp1 MGIID:106661 Length:721 Species:Mus musculus

Alignment Length:433 Identity:105/434 (24%)
Similarity:188/434 (43%) Gaps:95/434 (22%)


  Fly    31 LVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERDSHKAVSLNQQLDLDLGKGLYRT 95
            ||||:.:.:..:.|...::..:|:|.|  |.:|::.:|.:..:...|.:|..:      ..||..
Mouse    24 LVCYFTNWAHSRPGPASIMPHDLDPFL--CTHLIFAFASMSNNQIVAKNLQDE------NVLYPE 80

  Fly    96 VTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGL 160
            ..:||.:...:|.|||:||         .....:::..:|.:...|.:|:::|.|.::.:|||||
Mouse    81 FNKLKERNRELKTLLSIGG---------WNFGTSRFTAMLSTLANREKFIDSVISFLRIHGFDGL 136

  Fly   161 DVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPD----- 220
            |:.:.:|..:....|    ..|                      .|..|:.:::.||..:     
Mouse   137 DLFFLYPGLRGSPPH----DRW----------------------NFLFLIEELQFAFEREALLTQ 175

  Fly   221 --NLLLSTTV--LPN-VNSSLFYDIPAVVNYLDFVNL------GTFDFFTPQRNPEVADYAAPIY 274
              .||||..|  :|: :::|  ||...:...|||:|:      |:::.||        .:.:|::
Mouse   176 HPRLLLSAAVSGIPSIIHTS--YDALLLGRRLDFINVLSYDLHGSWEKFT--------GHNSPLF 230

  Fly   275 ELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVKDVKDEAPVGGN 339
            .|.|.:.  :.|..:.||.:...||.|:.:|..||||.:.|..:| ..|:....  ...|..|..
Mouse   231 SLPEDSK--SSAYAMNYWRKLGTPADKLIMGFPTYGRNFYLLKES-KNGLQTAS--MGPASPGKY 290

  Fly   340 TQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPD 404
            |:..|..::.|||:.                  ||...|.:..|.|.....||..  |:.::|..
Mouse   291 TKQAGFLAYYEVCSF------------------VQRAKKHWIDYQYVPYAFKGKE--WLGYDDTI 335

  Fly   405 TAADKAGYVRTENLGGVALFDLSYDDFRG-LCTNEKYPILRAI 446
            :.:.||.||:.|:.||..::.|..||.|| .|.|..:|::..:
Mouse   336 SFSYKAMYVKREHFGGAMVWTLDMDDVRGTFCGNGPFPLVHIL 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 105/434 (24%)
Glyco_18 31..429 CDD:214753 98/414 (24%)
Ovgp1NP_031722.1 Glyco_18 23..360 CDD:214753 98/414 (24%)
GH18_chitolectin_chitotriosidase 24..382 CDD:119351 105/434 (24%)
21 X 7 AA tandem repeats of S-K-[TAI]-[TI]-[TAP]-[GED]-[IVM] 486..632
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65956904
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.