DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Chil3

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_034022.2 Gene:Chil3 MGIID:1330860 Length:398 Species:Mus musculus

Alignment Length:469 Identity:114/470 (24%)
Similarity:204/470 (43%) Gaps:111/470 (24%)


  Fly     1 MIIKALAIVSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVY 65
            :::..|||    |.::|...       ...|:|||.|.:..:...|......::|.|  |.:|:|
Mouse     5 ILVTGLAI----LLNVQLGS-------SYQLMCYYTSWAKDRPIEGSFKPGNIDPCL--CTHLIY 56

  Fly    66 GYAGIERDSHKAVSLNQQLDL-DLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPN 129
            .:||::.:.   ::...:.|| |     |..:..||.|...:|.||::||         .|..|.
Mouse    57 AFAGMQNNE---ITYTHEQDLRD-----YEALNGLKDKNTELKTLLAIGG---------WKFGPA 104

  Fly   130 KYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFP--KNKPKKVHSGIGSLWKGFKKVFSGD 192
            .:..::.:|..|..|:.:|...::.|.||||::.||:|  :..|.|                   
Mouse   105 PFSAMVSTPQNRQIFIQSVIRFLRQYNFDGLNLDWQYPGSRGSPPK------------------- 150

  Fly   193 SIVDEKSEEHKEQFTALLRDVKNAFRPDN-------LLLSTT---VLPNVNSSLFYDIPAVVNYL 247
                     .|..|:.|:::::.||..::       |||::|   ::..:.|.  |.||.:...|
Mouse   151 ---------DKHLFSVLVKEMRKAFEEESVEKDIPRLLLTSTGAGIIDVIKSG--YKIPELSQSL 204

  Fly   248 DFVNLGTFDF------FTPQRNPEVADYAAPIYELSERNPEFNVAAQVKYWLRNNCPASKINVGV 306
            |::.:.|:|.      :|.:.:|.   |.:| |::. ::.:.||.:.:.||..:...:.|:.||.
Mouse   205 DYIQVMTYDLHDPKDGYTGENSPL---YKSP-YDIG-KSADLNVDSIISYWKDHGAASEKLIVGF 264

  Fly   307 ATYGRPWKLTDDSGDTGV--PPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAP 369
            ..||..:.|:|.| .||:  |.:    ...|.|..|...|:.::.|||..|           |..
Mouse   265 PAYGHTFILSDPS-KTGIGAPTI----STGPPGKYTDESGLLAYYEVCTFL-----------NEG 313

  Fly   370 LIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRG- 433
            ..:|.| |.:...|||:..:       ||.:::..:...||.:::..||||..::.|..|||.| 
Mouse   314 ATEVWD-APQEVPYAYQGNE-------WVGYDNVRSFKLKAQWLKDNNLGGAVVWPLDMDDFSGS 370

  Fly   434 LCTNEKYPILRAIK 447
            .|....:|:...:|
Mouse   371 FCHQRHFPLTSTLK 384

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 109/441 (25%)
Glyco_18 31..429 CDD:214753 102/419 (24%)
Chil3NP_034022.2 GH18_chitolectin_chitotriosidase 24..387 CDD:119351 109/440 (25%)
Glyco_18 26..365 CDD:214753 101/417 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65397961
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.