DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Chil1

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_031721.2 Gene:Chil1 MGIID:1340899 Length:389 Species:Mus musculus

Alignment Length:458 Identity:122/459 (27%)
Similarity:208/459 (45%) Gaps:111/459 (24%)


  Fly     9 VSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERD 73
            |.:.|.|..|.|          ||||:.|.|..:||:|..:.|.::|.|  |.:::|.:|.|..|
Mouse    20 VLMLLQSCSAYK----------LVCYFTSWSQYREGVGSFLPDAIQPFL--CTHIIYSFANISSD 72

  Fly    74 SHKAV-SLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLES 137
            :..:. ..|.:.:       |..:.:||.:..|:|.||||||.|..|         .::.|:..:
Mouse    73 NMLSTWEWNDESN-------YDKLNKLKTRNTNLKTLLSVGGWKFGE---------KRFSEIASN 121

  Fly   138 PTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEH 202
            ...||.||.:|...:::|||||||:||.:|:.:                               .
Mouse   122 TERRTAFVRSVAPFLRSYGFDGLDLAWLYPRLR-------------------------------D 155

  Fly   203 KEQFTALLRDVKNAF----RP--DNLLLSTTV-LPNVNSSLFYDIPAVVNYLDFVNLGTFDFFTP 260
            |:.|:.|::::...|    :|  :.||||..: ...|.....|||..:..:|||:||.|:||...
Mouse   156 KQYFSTLIKELNAEFTKEVQPGREKLLLSAALSAGKVAIDTGYDIAQIAQHLDFINLMTYDFHGV 220

  Fly   261 QRNPEVADYAAPIYELSERNPEF----NVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGD 321
            .|  ::..:.:|::: .:::..|    ||...|:|.:|....|||:.:|:.|:|:.:.|......
Mouse   221 WR--QITGHHSPLFQ-GQKDTRFDRYSNVNYAVQYMIRLGAQASKLLMGIPTFGKSFTLASSENQ 282

  Fly   322 TGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYR 386
            .|.|    :..|...|..|:..|..::.|:|        .:||||.                .:|
Mouse   283 LGAP----ISGEGLPGRFTKEAGTLAYYEIC--------DFLKGAE----------------VHR 319

  Fly   387 AADK------KGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRGLC-TNEKYPILR 444
            .:::      ||:.  ||.:||.::..:|.|:::.:.|.|..::.|..|||:|.| ..|.:|:..
Mouse   320 LSNEKVPFATKGNQ--WVGYEDKESVKNKVGFLKEKKLAGAMVWALDLDDFQGTCQPKEFFPLTN 382

  Fly   445 AIK 447
            |||
Mouse   383 AIK 385

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 117/438 (27%)
Glyco_18 31..429 CDD:214753 107/416 (26%)
Chil1NP_031721.2 Glyco_18 31..366 CDD:214753 108/427 (25%)
GH18_chitolectin_chitotriosidase 32..388 CDD:119351 117/437 (27%)
Chitooligosaccharide binding. {ECO:0000250} 79..80 0/1 (0%)
Chitooligosaccharide binding. {ECO:0000250} 106..109 2/3 (67%)
Chitooligosaccharide binding. {ECO:0000250} 213..216 1/3 (33%)
Important for AKT1 activation and IL8 production 333..347 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66243014
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.