DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Chia

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_997469.1 Gene:Chia RGDID:1303058 Length:473 Species:Rattus norvegicus

Alignment Length:447 Identity:117/448 (26%)
Similarity:200/448 (45%) Gaps:108/448 (24%)


  Fly    30 HLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERDSHKAVSLNQQLDLDLGKGLYR 94
            :||||:.:.:..:.|||....|::.|.|  |.:|:|.:||::.:....:..|...       ||:
  Rat    23 NLVCYFTNWAQYRPGLGSFKPDDINPCL--CTHLIYAFAGMQNNQITTIEWNDVT-------LYK 78

  Fly    95 TVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDG 159
            ....||.:...:|.||::||       .:....|  :..::.:...|..|:.:|...::.|||||
  Rat    79 AFNDLKNRNSKLKTLLAIGG-------WNFGTAP--FTTMVSTSQNRQTFITSVIKFLRQYGFDG 134

  Fly   160 LDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAF------- 217
            ||:.|::|.::        ||                  ..:.|..||.|:::::.||       
  Rat   135 LDLDWEYPGSR--------GS------------------PPQDKHLFTVLVKELREAFEQEAIES 173

  Fly   218 -RPDNLLLSTTVLPNV-NSSLFYDIPAVVNYLDFVNL------GTFDFFTPQRNPEVADYAAPIY 274
             || .|:::..|...: |....|:||.:..||||:::      |::|.:|.:.        :|:|
  Rat   174 NRP-RLMVTAAVAAGISNIQAGYEIPELSQYLDFIHVMTYDLHGSWDGYTGEN--------SPLY 229

  Fly   275 EL---SERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVKDVKDEAPV 336
            :|   :..|...||...:.||..|..||.|:.||...||..:.|::.| |||:        .||.
  Rat   230 KLPTETGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPEYGHTYILSNPS-DTGI--------GAPT 285

  Fly   337 GGN------TQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQD-PAKRFGSYAYRAADKKGDN 394
            .||      |:..|.:::.|:|..|.|       ||      .|| .|.:...|||     ||:.
  Rat   286 SGNGPAGPYTRQAGFWAYYEICTFLRN-------GA------TQDWDAPQEVPYAY-----KGNE 332

  Fly   395 GIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRG-LCTNEKYPILRAIKYRL 450
              ||.:::..:.:.||.:::..|.||..::.:..|||.| .|...|:|:...:...|
  Rat   333 --WVGYDNIKSFSVKAQWLKQNNFGGAMIWAIDLDDFTGSFCDQGKFPLTSTLNKAL 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 116/446 (26%)
Glyco_18 31..429 CDD:214753 109/423 (26%)
ChiaNP_997469.1 GH18_chitolectin_chitotriosidase 24..387 CDD:119351 116/445 (26%)
Glyco_18 24..365 CDD:214753 109/423 (26%)
Chitooligosaccharide binding. {ECO:0000250} 70..71 0/1 (0%)
Chitooligosaccharide binding. {ECO:0000250} 97..100 2/10 (20%)
Chitooligosaccharide binding. {ECO:0000250} 210..213 0/3 (0%)
ChtBD2 426..473 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65401076
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.