DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and CHI3L2

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_003991.2 Gene:CHI3L2 HGNCID:1933 Length:390 Species:Homo sapiens

Alignment Length:441 Identity:119/442 (27%)
Similarity:197/442 (45%) Gaps:103/442 (23%)


  Fly    31 LVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERDSHKAVSLNQQLDLDLGKGLYRT 95
            ||||:.:.|..::..||...:.::|.|  |.:|:|.:|.||.:.   |.:..:.::    .||:|
Human    29 LVCYFTNWSQDRQEPGKFTPENIDPFL--CSHLIYSFASIENNK---VIIKDKSEV----MLYQT 84

  Fly    96 VTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYL-------ELLESPTGRTRFVNTVYSLVK 153
            :..||.|.|.:|||||:||                ||       .:::|.|.|..|:|::...::
Human    85 INSLKTKNPKLKILLSIGG----------------YLFGSKGFHPMVDSSTSRLEFINSIILFLR 133

  Fly   154 TYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFR 218
            .:.||||||:|.:|                            |:|...|   ||.|:.::..||:
Human   134 NHNFDGLDVSWIYP----------------------------DQKENTH---FTVLIHELAEAFQ 167

  Fly   219 PD-------NLLLSTTVLPN---VNSSLFYDIPAVVNYLDFVNLGTFDFFTPQRNPEVADYAAPI 273
            .|       .|||:..|...   :::|  |.:..:...|||:||.:|||......|.:..:.:|:
Human   168 KDFTKSTKERLLLTAGVSAGRQMIDNS--YQVEKLAKDLDFINLLSFDFHGSWEKPLITGHNSPL 230

  Fly   274 YE-LSERNPE--FNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVKDVKDEAP 335
            .: ..:|.|.  :||...|.||:....|:.|:.:|:.|||..:.|.......|.|    ......
Human   231 SKGWQDRGPSSYYNVEYAVGYWIHKGMPSEKVVMGIPTYGHSFTLASAETTVGAP----ASGPGA 291

  Fly   336 VGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSF 400
            .|..|:..|..::.|:|        .:||||.  :.::||...   .||.     ||:.  ||.:
Human   292 AGPITESSGFLAYYEIC--------QFLKGAK--ITRLQDQQV---PYAV-----KGNQ--WVGY 336

  Fly   401 EDPDTAADKAGYVRTENLGGVALFDLSYDDFRG-LCTNEKYPILRAIKYRL 450
            :|..:...|..:::..||||..::.:..|||.| .|....||:::|:|..|
Human   337 DDVKSMETKVQFLKNLNLGGAMIWSIDMDDFTGKSCNQGPYPLVQAVKRSL 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 118/440 (27%)
Glyco_18 31..429 CDD:214753 109/418 (26%)
CHI3L2NP_003991.2 GH18_chitolectin_chitotriosidase 29..387 CDD:119351 118/440 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66131370
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.