DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Chil4

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_660108.2 Gene:Chil4 MGIID:1341098 Length:402 Species:Mus musculus

Alignment Length:465 Identity:111/466 (24%)
Similarity:201/466 (43%) Gaps:103/466 (22%)


  Fly     1 MIIKALAIVSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVY 65
            :::..|||    |.::|...       ...|:|||.|.:..:...|......::|.|  |.:|:|
Mouse     5 ILVTGLAI----LLNVQLGS-------SYQLMCYYTSWAKDRPTEGSFKPGNIDPCL--CTHLIY 56

  Fly    66 GYAGIERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNK 130
            .:||::  :::...|::|   ||..  |..:..||.:...:|.||::||         .|..|..
Mouse    57 AFAGMK--NNEITYLSEQ---DLRD--YEALNGLKDRNTELKTLLAIGG---------WKFGPAP 105

  Fly   131 YLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFP--KNKPKKVHSGIGSLWKGFKKVFSGDS 193
            :..::.:|..|..|:.:|...::.|.||||::.||:|  :..|.|                    
Mouse   106 FSSMVSTPQNRQTFIKSVIRFLRQYNFDGLNLDWQYPGSRGSPPK-------------------- 150

  Fly   194 IVDEKSEEHKEQFTALLRDVKNAFRPDN-------LLLSTT---VLPNVNSSLFYDIPAVVNYLD 248
                    .|..|:.|:::::.||..::       |||::|   .:..:.|.  |.||.:...||
Mouse   151 --------DKHLFSVLVQEMRKAFEEESTLNHIPRLLLTSTGAGFIDVIKSG--YKIPELSQSLD 205

  Fly   249 FVNLGTFDFFTPQRNPEVAD----YAAPIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATY 309
            ::.:.|:|...| :|....:    |.:| |::. ::.:.||.:.:.||..:...:.|:.||...|
Mouse   206 YIQVMTYDLHDP-KNGYTGENSPLYKSP-YDIG-KSADLNVDSIITYWKDHGAASEKLIVGFPAY 267

  Fly   310 GRPWKLTDDS-GDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKV 373
            |..:.|:|.| ...|.|.|    ...|.|..|...|:.::.|:|..|           |....::
Mouse   268 GHTFILSDPSKNGIGDPTV----SAGPPGKYTNEQGLLAYFEICTFL-----------NEGATEI 317

  Fly   374 QDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRG-LCTN 437
            .|..:.. .|||...:       ||.:::..:...||.:::..||||..::.|..|||.| .|..
Mouse   318 FDATQEV-PYAYLGNE-------WVGYDNVRSFKLKAQWLKDNNLGGAVVWPLDMDDFSGSFCHQ 374

  Fly   438 EKYPILRAIK 447
            .::|:...:|
Mouse   375 GRFPLTTTLK 384

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 106/437 (24%)
Glyco_18 31..429 CDD:214753 99/415 (24%)
Chil4NP_660108.2 GH18_chitolectin_chitotriosidase 24..387 CDD:119351 106/436 (24%)
Glyco_18 26..365 CDD:214753 98/413 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65398698
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.