DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and LOC102555481

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_008773506.1 Gene:LOC102555481 RGDID:7502014 Length:320 Species:Rattus norvegicus

Alignment Length:449 Identity:90/450 (20%)
Similarity:157/450 (35%) Gaps:147/450 (33%)


  Fly     5 ALAIVSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAG 69
            |..|::..||.:..:.:|:    ...|:|||.|.:..:..:|...|..::|.|  |.:|:..:||
  Rat     2 AKLILATGLAILLYAHLGS----SYQLMCYYTSWAKERPTVGSFKIGNIDPCL--CTHLICAFAG 60

  Fly    70 IERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLEL 134
            :.  :::.::.::|..:|     |..:..||.:...:|.||::||.|       ....|  :..:
  Rat    61 MR--NNEIINTSEQDLID-----YEALNYLKDRNTELKTLLAIGGWK-------FGSAP--FSAM 109

  Fly   135 LESPTGRTRFVNTV-YSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEK 198
            :.:|..|..|:.:. |..|.||.                                          
  Rat   110 VSTPQNRQTFIKSFDYIQVMTYN------------------------------------------ 132

  Fly   199 SEEHKEQFTALLRDVKNAFRPDNLLLSTTVLPNVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQRN 263
                       |.|.::.:..:|             |..|..|             ||       
  Rat   133 -----------LHDFQDGYTGEN-------------SPLYQSP-------------FD------- 153

  Fly   264 PEVADYAAPIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGV-PPV 327
              ...||           ..||.|.:.||..|.....|:.||...||..:.|:|.| :||: .|:
  Rat   154 --TGKYA-----------YLNVDAIISYWKENGAAREKLIVGFPAYGHNFILSDPS-NTGIGAPI 204

  Fly   328 KDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKG 392
            ...   .|.|..|...|::::.|:|..|.:.......|.......||                  
  Rat   205 VSA---GPPGKFTGEAGLWAYYEICTFLNDGATDLWDGPQEVPYAVQ------------------ 248

  Fly   393 DNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRG-LCTNEKYPILRAIKYRL 450
             ..:||.:::..:...||.:::...|||..::.|..|||.| .|...::|:...:|:.|
  Rat   249 -GNVWVGYDNVKSFKIKAQWLKDNKLGGAMVWPLDMDDFTGSFCHQGRFPLTSTLKHYL 306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 84/423 (20%)
Glyco_18 31..429 CDD:214753 77/400 (19%)
LOC102555481XP_008773506.1 GH18_chitinase-like 24..306 CDD:299167 84/422 (20%)
Glyco_18 26..284 CDD:214753 76/398 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.