DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and ovgp1

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_021335667.1 Gene:ovgp1 ZFINID:ZDB-GENE-140106-118 Length:490 Species:Danio rerio

Alignment Length:442 Identity:113/443 (26%)
Similarity:186/443 (42%) Gaps:96/443 (22%)


  Fly    31 LVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERDSHKAVS-LNQQLDLDLGKGLYR 94
            ||||:.:.|..:.|..:.:.:.::|.|  |.:|:|.:|.|...::.|.| .|..:.       |.
Zfish    10 LVCYFTNWSQYRSGTARYLPENVDPNL--CTHLIYAFAIINYANNIAGSEWNDVVH-------YS 65

  Fly    95 TVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDG 159
            |....|::.|.:..||||       .|:|:    :::..:|.....|..|:.:....::.|.|||
Zfish    66 TFNAHKKRNPQLITLLSV-------RDQDS----SQFSIMLSKWINRQTFIKSSIEFLRKYNFDG 119

  Fly   160 LDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPDNLLL 224
            ||:.|:. ||                         ..|...|.|.:|| ||..||.....:|.||
Zfish   120 LDLDWEM-KN-------------------------TSEMHPEDKLKFT-LLCKVKTKHITENELL 157

  Fly   225 STTVLPNVNSSL-----------------FYDIPAVVNYLDFVNLGTFDFFTPQRNPEVADYAAP 272
            ...|..::||..                 .|.||.:..||||:|:.||||.|.:..  :|.:.:.
Zfish   158 EAFVAESLNSDTRLILTATVSAQKDVIERSYIIPEISEYLDFINVKTFDFHTYKDG--IARHHSA 220

  Fly   273 IYEL--SERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVKDVKDEAP 335
            :|..  .:::.:.|....::||.....||.|:.:|.:||||.:.|.......|.|..|    .|.
Zfish   221 LYSAMSDDKDIKSNTDFALQYWRSQGAPAEKLLMGFSTYGRSFILNSSQNGVGAPANK----FAS 281

  Fly   336 VGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIK-VQDPAKRFGSYAYRAADKKGDNGIWVS 399
            .|.:||..|::::.|:|..|           |..::: ::|....|        ..||::  ||.
Zfish   282 PGPHTQEIGLWAYYEICLFL-----------NGGVVQWIEDQKVPF--------SVKGND--WVG 325

  Fly   400 FEDPDTAADKAGYVRTENLGGVALFDLSYDDFRG-LCTNEKYPILRAIKYRL 450
            |:...:...|..|:.....||..::.|..|||.| .|....||::.::|..|
Zfish   326 FDSLRSFNIKTKYLLEHGFGGAFVWALDLDDFSGYFCGQGTYPLVNSLKKSL 377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 112/441 (25%)
Glyco_18 31..429 CDD:214753 104/419 (25%)
ovgp1XP_021335667.1 GH18_chitinase-like 10..377 CDD:324582 112/441 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66266040
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.