DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and LOC100909585

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_017455034.1 Gene:LOC100909585 RGDID:6503112 Length:245 Species:Rattus norvegicus

Alignment Length:236 Identity:68/237 (29%)
Similarity:104/237 (44%) Gaps:60/237 (25%)


  Fly    31 LVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERDSHKAVSLNQQLDLDLGKGLYRT 95
            |||||.|.|..:||.|....|.|:..|  |.:::|.:|.|..|.......|...       ||..
  Rat    24 LVCYYTSWSQYREGDGSCFPDALDRFL--CTHIIYSFANISNDHIDTWEWNDVT-------LYGM 79

  Fly    96 VTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGL 160
            :..||.:.||:|.||||||         ......::.::..:...|..|:.:|...::|:|||||
  Rat    80 LNTLKNRNPNLKTLLSVGG---------WNFGSQRFSKIASNTQSRRTFIKSVPPFLRTHGFDGL 135

  Fly   161 DVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPD----- 220
            |:||.:|..                     ||          |:.||.|::::|..|..:     
  Rat   136 DLAWLYPGR---------------------GD----------KQHFTTLIKEMKAEFIKEAQPGK 169

  Fly   221 -NLLLSTTVLP---NVNSSLFYDIPAVVNYLDFVNLGTFDF 257
             .||||..:..   .::||  |||..:..:|||:::.|:||
  Rat   170 KQLLLSAALSAGKVTIDSS--YDIAKISQHLDFISIMTYDF 208

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 68/237 (29%)
Glyco_18 31..429 CDD:214753 68/237 (29%)
LOC100909585XP_017455034.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.