DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4927 and gzma

Sequence 1:NP_001033953.1 Gene:CG4927 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio

Alignment Length:267 Identity:72/268 (27%)
Similarity:112/268 (42%) Gaps:58/268 (22%)


  Fly   105 IVGGAKAAGREFPFMALLGQRGKNSSQIDWD--CGAIIIHPKFVLTAAHCLETSETKEQRLDPNY 167
            |||| |...:...:|.        |.|::.:  ||.|:||.::|||||||.|.|.:         
Zfish    28 IVGG-KDVKKALSWMV--------SIQVNQNHKCGGILIHKEWVLTAAHCKEDSYS--------- 74

  Fly   168 DGPKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYV 232
               ...|.:|.|..:..:     |...:.||.:...:.:.    ::|:||.::.|..:.....|.
Zfish    75 ---SVTVLIGSLSLSKGS-----QRIAIHNYEIPETFNKK----TKKDDIMLIRLSKKVKAKPYK 127

  Fly   233 APACLPLDGGNEQ-----LQVAAAGWGATSESG-HASSHLLKVSLDRYDVAECSQRL-EHKIDVR 290
            .|.       .|:     .:....|||.|...| .||..|..:.:...|..:|::.. .:.:..:
Zfish   128 IPK-------KEKDVQPGTKCVVRGWGTTDYKGKQASDKLQMLEVLVVDRVQCNRYYNRNPVITK 185

  Fly   291 TQLCAGSRSTSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYGLVCGVQGLPSVYT---KVHLYT 352
            ..||||:......||.||||||:       .|.|.::|:.|....||....|:|||   |.|:  
Zfish   186 DMLCAGNTQQHRGTCLGDSGGPL-------ECEKNLVGVLSGSHGCGDPKKPTVYTLLSKRHI-- 241

  Fly   353 DWIENIV 359
            .||..|:
Zfish   242 TWINKIL 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 71/265 (27%)
Tryp_SPc 105..355 CDD:214473 70/262 (27%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 71/265 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.