DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4927 and CG34290

Sequence 1:NP_001033953.1 Gene:CG4927 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001097899.2 Gene:CG34290 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster

Alignment Length:277 Identity:71/278 (26%)
Similarity:120/278 (43%) Gaps:45/278 (16%)


  Fly    98 SCRTTPFIVGG-----AKAAGREFPFMA----LLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCL 153
            ||...| ||||     ..::..::|||.    ::.:...|.......||..:|..:::|:||||:
  Fly    28 SCHAVP-IVGGRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSLISDRWILSAAHCV 91

  Fly   154 ETSETKEQRLDPNYDGPKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIA 218
               ..|.......:.|.:.:..:|:|         ||.....:.|:..       ...:.:||||
  Fly    92 ---WRKNIHYIAAFIGYENIENIGQL---------QPYGLESVEYIYF-------QPSNFRNDIA 137

  Fly   219 VVELEME--ATFSEYVAPACLPLDG----GNEQLQVAAAGWGATSESGHASSHLLKVSLDRYDVA 277
            ::.::..  :.|...:..|.||..|    .||..::  .|:|||..:|.....|.:..:...|..
  Fly   138 LLYMKRRYWSDFGNGLQYAQLPPHGMKPDQNESCRI--IGYGATHHAGPCQKRLFEAEVRVIDNQ 200

  Fly   278 ECSQRLEH---KIDVRTQLCAGSRSTSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYGLVCGVQ 339
            :|...:.|   ..:....:||  ...:.|:|.||||||:..   .|.....:.|:.|:||.||:.
  Fly   201 KCRDIIGHIWAPQNGANTVCA--LGNNQDSCQGDSGGPLIC---TYGGKDYIYGLVSHGLTCGIP 260

  Fly   340 GLPSVYTKVHLYTDWIE 356
            |:||:||....|.||::
  Fly   261 GMPSIYTVTRPYYDWVQ 277

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 68/271 (25%)
Tryp_SPc 105..355 CDD:214473 68/268 (25%)
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 68/269 (25%)
Tryp_SPc 34..276 CDD:214473 68/268 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48204
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.