DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4927 and si:dkey-21e2.10

Sequence 1:NP_001033953.1 Gene:CG4927 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_009294620.1 Gene:si:dkey-21e2.10 ZFINID:ZDB-GENE-050208-778 Length:249 Species:Danio rerio

Alignment Length:303 Identity:81/304 (27%)
Similarity:122/304 (40%) Gaps:64/304 (21%)


  Fly    60 IVCCLLPNNMQPQSQQFSANIGLRRFEKECRRFNEIRTSCRTTPFIVGGAKAAGREFPFMALLGQ 124
            |:..||..::.|. ..|:|.:|::                       .|.:|.....|:|..| |
Zfish     3 IISLLLLVSLVPH-LTFTARVGIQ-----------------------DGTEAKPHSRPYMVSL-Q 42

  Fly   125 RGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLGELDYNSTTDDAQ 189
            ..|...     ||..:|..:||||||||.|..:.             ..|..|..|...   .|.
Zfish    43 FYKLHM-----CGGSLITEEFVLTAAHCWEEDDV-------------LTVVTGAHDLRK---KAI 86

  Fly   190 PQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAPACLPLDGGNEQLQV--AAAG 252
            ...::|.:|:.||    |.::.:.:|||.:::|:.:...|..|....||.||.:.:...  :.||
Zfish    87 NNVYKVKSYIPHP----DFNSKTLENDIMLLQLKTKVRLSNNVGLISLPKDGEDVKADTLCSVAG 147

  Fly   253 WGATSESGHASSHLLKVSLDRYDVAECSQRLEHKIDVRTQLCAGSRSTSADTCYGDSGGPVFVQH 317
            ||.....|..:..|.:......:.|||.:|.|........:|....   ..||.||||||:.   
Zfish   148 WGDLWSKGPETDRLREAETVIVNNAECERRWESDYVASKMICVYGH---GGTCSGDSGGPLV--- 206

  Fly   318 PIYSCLKQVIGITSYG--LVCGVQGLPSVYTKVHLYTDWIENI 358
                |...|:||||:|  .:|..:..|.|:|::..|..||.||
Zfish   207 ----CGDTVVGITSFGEPYLCNSRLFPDVHTRISAYLPWIHNI 245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 73/257 (28%)
Tryp_SPc 105..355 CDD:214473 71/254 (28%)
si:dkey-21e2.10XP_009294620.1 Tryp_SPc 27..242 CDD:214473 71/251 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.