DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4927 and CG11843

Sequence 1:NP_001033953.1 Gene:CG4927 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster

Alignment Length:271 Identity:118/272 (43%)
Similarity:151/272 (56%) Gaps:24/272 (9%)


  Fly    93 NEIRTSCRT-TPFIVGGAKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETS 156
            :.|..:||: ||.||||..|..||||.||.||:|...||:.||.||.::|..:||||||||||:.
  Fly    55 SRIIDNCRSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESE 119

  Fly   157 ETKEQRLDPNYDGPKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVE 221
            .           |...||||||||::|..:||.|:|:.|..|:.||.| ||...   .:||.:|:
  Fly   120 R-----------GEVNVVRLGELDFDSLDEDAAPRDYMVAGYIAHPGY-EDPQF---YHDIGLVK 169

  Fly   222 LEMEATFSEYVAPACLPLDGGNEQLQVAAAGWGATSESGHASSHLLKVSLDRYDVAECSQRLEHK 286
            |.....|..|..|||||...........|.|||:|..:...|:.||||.|.||....|.:.|..:
  Fly   170 LTEAVVFDLYKHPACLPFQDERSSDSFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQ 234

  Fly   287 I-------DVRTQLCAGSRSTSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYGLVCGVQGLPSV 344
            :       |...|||.|| ..:.|||.||||||:.:.|..|.|:..|:||||.||.||..|:|.:
  Fly   235 VEEFPRGFDGNNQLCVGS-EMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGI 298

  Fly   345 YTKVHLYTDWI 355
            ||:|:.|..||
  Fly   299 YTRVYPYLGWI 309

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 113/259 (44%)
Tryp_SPc 105..355 CDD:214473 112/257 (44%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 113/259 (44%)
Tryp_SPc 68..309 CDD:214473 112/257 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BPQ8
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4734
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.