DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4927 and CG11841

Sequence 1:NP_001033953.1 Gene:CG4927 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster

Alignment Length:309 Identity:114/310 (37%)
Similarity:155/310 (50%) Gaps:37/310 (12%)


  Fly    54 CDKSNHIVCCLLPNNMQPQSQQFSANIGLRRFEKECRRFNEIRTSCR-TTPFIVGGAKAAGREFP 117
            |.|...||              |...:.:..|..:.....|...||. :.|.||.|..|..:|||
  Fly    34 CTKFKQIV--------------FEERVAISFFFTDAPITYETVDSCHGSRPLIVDGTPAEPKEFP 84

  Fly   118 FMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLGELDYN 182
            |.|.||.| |.:::|.|.||..:|..:.|||||||..:..           |...|||||||:::
  Fly    85 FAARLGHR-KTNNEIKWFCGGTLISNRLVLTAAHCFFSEH-----------GEVNVVRLGELEFD 137

  Fly   183 STTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAPACLPLDGGNEQLQ 247
            :.||||:|:||.||....||.:    :.....|||.:|:|:.|..|:.|..|||||.|.|.:...
  Fly   138 TDTDDAEPEDFGVLALKAHPGF----ENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGEQHES 198

  Fly   248 VAAAGWGATSESGHASSHLLKVSLDRY-----DVAECSQRLEHKIDVRTQLCAGSRSTSADTCYG 307
            ..|.|||....:...|..||||.|..|     ...:.:..|.:..:.::|||.|||. :.|||.|
  Fly   199 FIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGYEPKSQLCIGSRD-NKDTCNG 262

  Fly   308 DSGGPVFVQHPIYSCLKQVIGITSYGLVCGVQGLPSVYTKVHLYTDWIE 356
            ||||||...|...:|:..|:||||.|:.|....:||.||:||.:.:||:
  Fly   263 DSGGPVLAYHKDLACMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWIK 311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 104/258 (40%)
Tryp_SPc 105..355 CDD:214473 103/255 (40%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 104/256 (41%)
Tryp_SPc 72..310 CDD:214473 103/255 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BPQ8
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4734
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.