| Sequence 1: | NP_001033953.1 | Gene: | CG4927 / 36852 | FlyBaseID: | FBgn0034139 | Length: | 362 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_651661.1 | Gene: | CG11841 / 43430 | FlyBaseID: | FBgn0039628 | Length: | 319 | Species: | Drosophila melanogaster | 
| Alignment Length: | 309 | Identity: | 114/309 - (36%) | 
|---|---|---|---|
| Similarity: | 155/309 - (50%) | Gaps: | 37/309 - (11%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly    54 CDKSNHIVCCLLPNNMQPQSQQFSANIGLRRFEKECRRFNEIRTSCR-TTPFIVGGAKAAGREFP 117 
  Fly   118 FMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLGELDYN 182 
  Fly   183 STTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAPACLPLDGGNEQLQ 247 
  Fly   248 VAAAGWGATSESGHASSHLLKVSLDRY-----DVAECSQRLEHKIDVRTQLCAGSRSTSADTCYG 307 
  Fly   308 DSGGPVFVQHPIYSCLKQVIGITSYGLVCGVQGLPSVYTKVHLYTDWIE 356  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG4927 | NP_001033953.1 | Tryp_SPc | 105..358 | CDD:238113 | 104/257 (40%) | 
| Tryp_SPc | 105..355 | CDD:214473 | 102/254 (40%) | ||
| CG11841 | NP_651661.1 | Tryp_SPc | 72..311 | CDD:238113 | 103/255 (40%) | 
| Tryp_SPc | 72..310 | CDD:214473 | 102/254 (40%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E33208_3BPQ8 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 119 | 1.000 | Inparanoid score | I4773 | 
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D105391at6960 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0012717 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.870 | |||||