DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4927 and CG11670

Sequence 1:NP_001033953.1 Gene:CG4927 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001097767.2 Gene:CG11670 FlyBaseID:FBgn0038114 Length:404 Species:Drosophila melanogaster

Alignment Length:276 Identity:84/277 (30%)
Similarity:134/277 (48%) Gaps:48/277 (17%)


  Fly   107 GGAKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPK 171
            |.:..|..::|.||.||.|.:| .:||:.||..:|..:|||||||||.|..|...          
  Fly   145 GRSIVAPGQYPHMAALGFRNEN-HEIDYKCGGSLISEEFVLTAAHCLTTHGTSPD---------- 198

  Fly   172 YVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAPAC 236
             :|::|::.......:..||..||....:||.|    :.....:||.:::|.....::.:|.|..
  Fly   199 -IVKIGDIKLKEWELNVAPQRRRVAQIYLHPLY----NASLNYHDIGLIQLNRPVEYTWFVRPVR 258

  Fly   237 L-PLDG---GNEQLQVAAAGWGATSESGHASSHLLKVSLDRYDVAECSQRL------EHKIDVRT 291
            | |::.   |    ::...|:|:|..:...::.|.::.|....:.:|:..|      .|.: :.:
  Fly   259 LWPMNDIPYG----KLHTMGYGSTGFAQPQTNILTELDLSVVPIEQCNSSLPADEGSPHGL-LTS 318

  Fly   292 QLCAGSRSTSADTCYGDSGGPVFV------------QHPIYSCLKQVIGITSYGLVCGVQGLPSV 344
            |:||.....:.|||.||||||:.:            :|..|    .::||||||..|..: ||.|
  Fly   319 QICAHDYEKNRDTCQGDSGGPLQLNLERRRRRHTSRKHYRY----YLVGITSYGAYCRSE-LPGV 378

  Fly   345 YTKVHLYTDWIENIVW 360
            ||:|..|.|||.:|||
  Fly   379 YTRVSSYIDWIASIVW 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 81/273 (30%)
Tryp_SPc 105..355 CDD:214473 80/270 (30%)
CG11670NP_001097767.2 Tryp_SPc 145..392 CDD:238113 81/273 (30%)
Tryp_SPc 145..389 CDD:214473 80/270 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131167811
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.