DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4927 and CG11668

Sequence 1:NP_001033953.1 Gene:CG4927 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster

Alignment Length:427 Identity:118/428 (28%)
Similarity:170/428 (40%) Gaps:106/428 (25%)


  Fly     5 FGILLILAVICSILSEFCDNGT--------------GECKELSATDCPSIFFNLHLIRNFVKY-- 53
            ||..|||..:......:..|..              |.|:   |.|.|       ||...|:|  
  Fly     6 FGYRLILEFVLISTLAYAQNAPWNAVAPSYLSIDIYGNCQ---AHDRP-------LIGKCVRYVD 60

  Fly    54 ---------------CDKS--NHIVCC-----LLPNNMQPQSQQFSANIGLRRFEKECRRFNE-- 94
                           |..|  |.:|||     |||.....:|:|..||...|...|..||...  
  Fly    61 CISAMQAVPRVTPLLCPSSWPNQLVCCPHGGYLLPPPSISKSEQACANAYPRAHHKRRRRRRNTN 125

  Fly    95 ------------IRTSCRTTPFIVGGAKAAGREFPFMALLG----------QRGKNSSQIDWDCG 137
                        |:...::...:|||......|.|:|..||          :.|.:..:..::||
  Fly   126 PKLDQVELVEPIIQKHNQSQNLLVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCG 190

  Fly   138 AIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHP 202
            ..:|.|:|.:|||||.....          :.|. |..:|.::.||    .:.|...:.....||
  Fly   191 CAMIAPRFAITAAHCASVGG----------ESPS-VALIGGVELNS----GRGQLIEIKRISQHP 240

  Fly   203 AYGEDDDTGSRKNDIAVVELEMEATFSEYVAPACLPLDGGNEQLQVAAAGWGATSESGHASSHLL 267
            .:    |..:..||:|||:|...:    ::..|||.......:..:.|.|:|.|..:|..||:||
  Fly   241 HF----DAETLTNDLAVVKLARRS----HMPVACLWNQESLPERPLTALGYGQTKFAGPHSSNLL 297

  Fly   268 KVSLDRYDVAECSQRLEHKIDVRT------QLCAGSRSTSADTCYGDSGGPVFV-QHPIY--SCL 323
            ::.|...:..:| ||..|..|...      |:|||..|.:.|||.||||||:.: ||..:  ..:
  Fly   298 QIMLYHLNFQQC-QRYLHNYDKLANGLGSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTI 361

  Fly   324 KQVIGITSYGLVCGVQGLPSVYTKVHLYTDWIENIVW 360
            ..|:||||:|..| ..|.|.||.::..|..|||..||
  Fly   362 PYVVGITSFGGAC-ASGQPGVYVRIAHYIQWIEQQVW 397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 83/272 (31%)
Tryp_SPc 105..355 CDD:214473 81/269 (30%)
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 83/271 (31%)
Tryp_SPc 149..392 CDD:214473 81/268 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131167675
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.