DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and CG16749

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:262 Identity:83/262 - (31%)
Similarity:116/262 - (44%) Gaps:43/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 IVGGAKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDG 169
            :|.|..::..::||  ::..||.:.|.   .||..||..:||:|||||  |...|...|...|  
  Fly    30 VVNGTDSSVEKYPF--VISMRGSSGSH---SCGGSIISKQFVMTAAHC--TDGRKASDLSVQY-- 85

  Fly   170 PKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEY-VA 233
                   |....|:|    .|...||...:.|..|   :...:..|||:::.:|....|... ||
  Fly    86 -------GVTKINAT----GPNVVRVKKIIQHEDY---NPYNNYANDISLLLVEEPFEFDGVTVA 136

  Fly   234 PACLP--------LDGGNEQLQVAAAGWGATSESGHASSHLLKVSLDRYDVAECSQRLEHKIDVR 290
            |..||        .|.|.|.:.:   |||..:..|:..|.|.:|.|..|...||::|...:.|.|
  Fly   137 PVKLPELAFATPQTDAGGEGVLI---GWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPR 198

  Fly   291 TQLCAGSRSTSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYGL-VCGVQGLPSVYTKVHLYTDW 354
            ..:|.|........|.||||||:     ||:  .|.:||.|:.: .|.|...|.||.||..|.||
  Fly   199 YHICGGVDEGGKGQCSGDSGGPL-----IYN--GQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDW 256

  Fly   355 IE 356
            |:
  Fly   257 IK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 83/262 (32%)
Tryp_SPc 105..355 CDD:214473 81/259 (31%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 81/259 (31%)
Tryp_SPc 30..259 CDD:238113 83/262 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456068
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.