DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and CG4998

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster


Alignment Length:319 Identity:90/319 - (28%)
Similarity:137/319 - (42%) Gaps:62/319 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VCCLLPNNMQPQSQQFSANIGLRRFEKECRRFNEIRTSCRTTPFIVGGAKAAGREFPF-MALLGQ 124
            |||..|...|...||| ...|:|.......|..        .|..|.|....| |:|: :|:|.:
  Fly   903 VCCRRPLRPQAPPQQF-GRCGVRNAAGITGRIK--------NPVYVDGDSEFG-EYPWHVAILKK 957

  Fly   125 RGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLGELDYNSTTDDAQ 189
            ..|.|.   :.||..:|..:.:::||||:::....:.|           |||||.|.|...:...
  Fly   958 DPKESI---YACGGTLIDAQHIISAAHCIKSQNGFDLR-----------VRLGEWDVNHDVEFFP 1008

  Fly   190 PQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSE--YVAPACLP-----LDGGNEQLQ 247
            ..:..|::..:||.|    ..|:..||:||::|:....|::  :::|||||     ..|.    :
  Fly  1009 YIERDVVSVHIHPEY----YAGTLDNDLAVLKLDQPVDFTKNPHISPACLPDKYSDFTGA----R 1065

  Fly   248 VAAAGWG--ATSESGHASSHLLKVSLDRYDVAECSQRLEHKIDVRTQL-----------CAGSRS 299
            ....|||  |..|.|...:.|.:|.:......:|..:|.:     |:|           |||...
  Fly  1066 CWTTGWGKDAFGEHGKYQNILKEVDVPILSHQQCESQLRN-----TRLGYSYKLNPGFVCAGGEE 1125

  Fly   300 TSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYGLVCGVQGLPSVYTKVHLYTDWIENI 358
             ..|.|.||.|||:....   :....|:|:.|:|:.||...:|.||.||..|..||:.|
  Fly  1126 -GKDACKGDGGGPLVCDR---NGAMHVVGVVSWGIGCGQVNVPGVYVKVSAYLPWIQQI 1180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 77/273 (28%)
Tryp_SPc 105..355 CDD:214473 75/270 (28%)
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 75/269 (28%)
Tryp_SPc 942..1177 CDD:214473 73/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456099
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.