DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4927 and teq

Sequence 1:NP_001033953.1 Gene:CG4927 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_648288.2 Gene:teq FlyBaseID:FBgn0023479 Length:2792 Species:Drosophila melanogaster

Alignment Length:326 Identity:96/327 (29%)
Similarity:143/327 (44%) Gaps:70/327 (21%)


  Fly    71 PQSQQFS-------------------ANIGL-RRFEK------ECRRFNEIRT---SCRTTPFIV 106
            |:||::|                   :.||| .|..|      .|..|.:..|   :.|....:.
  Fly  2485 PRSQRYSQTQIKGGRSLGRETTPKTYSQIGLWERSSKAVHTPRRCGIFKDDLTDEYAHREERVVR 2549

  Fly   107 GGAKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPK 171
            |.....||. |:.|.:..||:......| |||::|..:.:|||||||             |..||
  Fly  2550 GNVAQRGRH-PWQATIRTRGRGGISSHW-CGAVVISKRHLLTAAHCL-------------YGSPK 2599

  Fly   172 --YVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSR-KNDIAVVELEMEATFSEYVA 233
              |.||:|: .|.:..:.::...| :.|:.:|    |:...|:. .||||:|.|:....||:||.
  Fly  2600 GAYFVRVGD-HYANIAESSEVDSF-IENWYLH----ENFRKGTHMNNDIALVVLKTPLKFSDYVQ 2658

  Fly   234 PACLPLDGGN--EQLQVAAAGWGATSESGHASSHLLKVSLDRYDVAE--CSQ-RLEHKIDVRTQL 293
            |.|||.....  |..:...:|||:. :||.::...:..|.:...:|:  |.| .:..........
  Fly  2659 PICLPDKNAELVEDRKCTISGWGSI-KSGVSTPAQVLGSAELPILADHVCKQSNVYGSAMSEGMF 2722

  Fly   294 CAGSRSTSADTCYGDSGGPVFVQHPIYSCL----KQVIGITSYGLVCGVQGLPSVYTKVHLYTDW 354
            ||||...|.|.|.||||||:.       |.    :.:.|:.|:|..||.:..|.||.:|:.|.||
  Fly  2723 CAGSMDESVDACEGDSGGPLV-------CSDDDGETLYGLISWGQHCGFKNRPGVYVRVNHYIDW 2780

  Fly   355 I 355
            |
  Fly  2781 I 2781

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 83/264 (31%)
Tryp_SPc 105..355 CDD:214473 82/262 (31%)
teqNP_648288.2 CBM_14 65..115 CDD:279884
ChtBD2 136..184 CDD:214696
ChtBD2 215..261 CDD:214696
ChtBD2 284..327 CDD:214696
CBM_14 521..569 CDD:279884
ChtBD2 608..654 CDD:214696
ChtBD2 709..752 CDD:214696
CBM_14 782..830 CDD:279884
ChtBD2 864..909 CDD:214696
CBM_14 942..993 CDD:279884
RCR <1051..1126 CDD:304939
RCR <1116..1210 CDD:304939
ChtBD2 1324..1369 CDD:214696
ChtBD2 1474..1518 CDD:214696
LDLa 2193..2222 CDD:238060
SR 2229..2331 CDD:214555
SRCR 2234..2332 CDD:278931
LDLa 2337..2370 CDD:197566
SR 2382..2480 CDD:214555
SRCR 2386..2480 CDD:278931
Tryp_SPc 2546..2781 CDD:214473 82/264 (31%)
Tryp_SPc 2547..2784 CDD:238113 83/265 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.