DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4927 and mas

Sequence 1:NP_001033953.1 Gene:CG4927 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_523919.1 Gene:mas FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster

Alignment Length:312 Identity:84/313 (27%)
Similarity:133/313 (42%) Gaps:46/313 (15%)


  Fly    58 NHIVCCLLPNNMQPQSQQFSANIGLRRFEKECRRFNEIRTSCRTTPFIVGGAKAAGREFPF-MAL 121
            ||......|:.:.|:..|..:..||           :...|.|....:|||......|:.: :||
  Fly   767 NHQAQADQPDLVYPEYYQQRSLYGL-----------QSNFSGRRRARVVGGEDGENGEWCWQVAL 820

  Fly   122 LGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLGELDYNSTTD 186
            :      :|...:.|||.:|..::|||||||:    |...|     .|....||:|  ||:.|..
  Fly   821 I------NSLNQYLCGAALIGTQWVLTAAHCV----TNIVR-----SGDAIYVRVG--DYDLTRK 868

  Fly   187 DAQP--QDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAPACLPLDGGNEQL--Q 247
            ...|  |..||....:|    .:.::.:..||||:::|..:|...:.|...|||..|.:...  :
  Fly   869 YGSPGAQTLRVATTYIH----HNHNSQTLDNDIALLKLHGQAELRDGVCLVCLPARGVSHAAGKR 929

  Fly   248 VAAAGWGATSESGHASSHLLKVSLDRYDVAECSQRLE---HKIDV--RTQLCAGSRSTSADTCYG 307
            ....|:|...|:|.....:.:..:......||.:::.   .||.:  .:..|||... ..|.|.|
  Fly   930 CTVTGYGYMGEAGPIPLRVREAEIPIVSDTECIRKVNAVTEKIFILPASSFCAGGEE-GHDACQG 993

  Fly   308 DSGGPVFVQHPIYSCLKQVIGITSYGLVCGVQGLPSVYTKVHLYTDWIENIV 359
            |.|||:..|...:   .::.|:.|:|..||.|.:|.||.|...:..||..|:
  Fly   994 DGGGPLVCQDDGF---YELAGLVSWGFGCGRQDVPGVYVKTSSFIGWINQII 1042

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 74/263 (28%)
Tryp_SPc 105..355 CDD:214473 73/260 (28%)
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 74/263 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47884
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.