DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4927 and CG3700

Sequence 1:NP_001033953.1 Gene:CG4927 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_611736.1 Gene:CG3700 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster

Alignment Length:360 Identity:229/361 (63%)
Similarity:283/361 (78%) Gaps:14/361 (4%)


  Fly     7 ILLILAVICSILSEFCDNGTGECKELSATDCPSIFFNLHLIRNFVKYCDKSNHIVCCLLP---NN 68
            |||::|.: |:::|:|||||||||||:.:|||.||:|.|||...|||||:.|.||||.:|   .|
  Fly     9 ILLLIASV-SVVTEYCDNGTGECKELTPSDCPVIFYNQHLIGAEVKYCDEFNDIVCCPIPLDHQN 72

  Fly    69 MQPQSQQFSANIGLRRFEKECRRFNEIRTSCRTTPFIVGGAKAAGREFPFMALLG--QRGKNSSQ 131
            ::|..|       .|.|||:|:::||:|::|::|||||||.||:|:|||||||:|  :..|:.|.
  Fly    73 LKPAEQ-------TRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSD 130

  Fly   132 IDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLGELDYNSTTDDAQPQDFRVL 196
            |:||||..::||||||||||||||.|:|.:|||||:|.||:||||||||||||||||..|||||:
  Fly   131 INWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVV 195

  Fly   197 NYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAPACLPLDGGNEQLQVAAAGWGATSESGH 261
            ||||||.|..:|:....|||||:|||:.:|.|:::||..|||.|.||:..||.|||||.|:: |.
  Fly   196 NYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVTAAGWGFTAD-GV 259

  Fly   262 ASSHLLKVSLDRYDVAECSQRLEHKIDVRTQLCAGSRSTSADTCYGDSGGPVFVQHPIYSCLKQV 326
            .|||||||:|.|:....|.:||...||.|||.||||.|:.||||.||||||:|||||:|.|||||
  Fly   260 KSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQV 324

  Fly   327 IGITSYGLVCGVQGLPSVYTKVHLYTDWIENIVWG 361
            |||.|||||||.||||||||||||||||||:||||
  Fly   325 IGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIVWG 359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 173/255 (68%)
Tryp_SPc 105..355 CDD:214473 171/252 (68%)
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 173/255 (68%)
Tryp_SPc 102..353 CDD:214473 171/252 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131167629
eggNOG 1 0.900 E33208_3BPQ8
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4734
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.