DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4927 and CG18477

Sequence 1:NP_001033953.1 Gene:CG4927 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_609763.1 Gene:CG18477 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster

Alignment Length:311 Identity:85/312 (27%)
Similarity:140/312 (45%) Gaps:51/312 (16%)


  Fly    61 VCCLLPNNMQPQSQQFSANIGLRRFEKECRRFNEIRTSCRTTPFIVGGAKAAGREFPFM-ALLGQ 124
            :||  |.|:..:..:...|..:.  :.:|...|....:........|.|:.|  |.|:| |||..
  Fly    69 ICC--PKNLIIKEPRLIINEPIT--DPQCGFVNSKGVTFSFREEDTGLAQEA--EVPWMVALLDA 127

  Fly   125 RGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLGELDYNSTTDDAQ 189
            |  .||.:   .|..:|.|..|:||          .||.: |....:.|||.||.|:::.|:...
  Fly   128 R--TSSYV---AGGALIAPHVVITA----------RQRTE-NMTASQLVVRAGEWDFSTKTEQLP 176

  Fly   190 PQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAPACLPLDGGN-EQLQVAAAGW 253
            ..|..:.:.|.||.:..::..    |::|:|.|....|.|.::.|.|:|....| :..:....||
  Fly   177 SVDVPIRSIVRHPGFNLENGA----NNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGW 237

  Fly   254 GATSESGHASSHLL-KVSLDRYDVAECSQRL------EHKIDVRTQLCAGSRSTSADTCYGDSGG 311
            |..|....:..::| |:||.......|.|:|      :.::| .:.:|||. ....|:|.||.|.
  Fly   238 GKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELD-NSLMCAGG-EPGKDSCEGDGGS 300

  Fly   312 PVFVQHPIYSC-LK------QVIGITSYGLVCGVQGLPSVYTKVHLYTDWI 355
            |:       :| :|      ::.||.::|:.||:.|:|:|||.|....:||
  Fly   301 PL-------ACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 78/268 (29%)
Tryp_SPc 105..355 CDD:214473 77/266 (29%)
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 76/262 (29%)
Tryp_SPc 113..344 CDD:238113 76/262 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.