DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4927 and CG4259

Sequence 1:NP_001033953.1 Gene:CG4927 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001259904.1 Gene:CG4259 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster

Alignment Length:280 Identity:77/281 (27%)
Similarity:111/281 (40%) Gaps:60/281 (21%)


  Fly    92 FNEIRTSC------RTTPFIVGGAKAAGREFPFMALLGQRGKNSSQIDW-----DCGAIIIHPKF 145
            :|:||...      .|.|::|             ::|.||       ||     ..|: :|:|..
  Fly    23 YNQIRRETYGSNPRATFPWVV-------------SVLDQR-------DWLFRYIGVGS-LINPNV 66

  Fly   146 VLTAAHCLETSETKEQRLDPNYDGPKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDT 210
            ||||||.| ...||       ||   .|||.||.| .|||.|.|..|..|||.|.|..:...:..
  Fly    67 VLTAAHIL-NGTTK-------YD---LVVRAGEWD-TSTTADQQHVDLEVLNIVSHEQFNRFNAE 119

  Fly   211 GSRKNDIAVVELEMEATFSEYVAPACLPL---DGGNEQLQVAAAGWGATSESGHASSHLLK-VSL 271
            .:....|.|...||.|..:      .:||   :.|.::......|||....:......:|| |.:
  Fly   120 NNMALLILVSAFEMTANIN------LIPLYLQEAGIQKGSCFFNGWGKVYLNSTDYPTVLKTVQV 178

  Fly   272 DRYDVAECSQRLEHKIDVRTQLCAGSRSTSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYGLVC 336
            |...:..||.|   |:.:: |:|  .:......|.||.|.|:..:...|......:||.::....
  Fly   179 DLLSMGMCSSR---KLPIQ-QIC--GKGLEGIDCSGDGGAPLVCRILTYPYKYAQVGIVNWLSQK 237

  Fly   337 GVQGLPSVYTKVHLYTDWIE 356
            .|:....|:|.|.....||:
  Fly   238 PVENTFIVFTNVAGLLPWID 257

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 72/262 (27%)
Tryp_SPc 105..355 CDD:214473 71/259 (27%)
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 73/265 (28%)
Tryp_SPc 39..256 CDD:214473 72/262 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.