| Sequence 1: | NP_001033953.1 | Gene: | CG4927 / 36852 | FlyBaseID: | FBgn0034139 | Length: | 362 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001245577.1 | Gene: | CG1632 / 31763 | FlyBaseID: | FBgn0030027 | Length: | 1056 | Species: | Drosophila melanogaster |
| Alignment Length: | 225 | Identity: | 50/225 - (22%) |
|---|---|---|---|
| Similarity: | 75/225 - (33%) | Gaps: | 67/225 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 148 TAAHCLETSETKEQRLDPNYDGPKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGS 212
Fly 213 RKNDIAVVELEMEATFSEYVAPACLPLDGGNEQL--QVAAAGWGATSESGHASSHLLKVSLDRYD 275
Fly 276 VAECSQRLEHKIDVRT--QLCAGSRSTSADTCYGD-SGGPVFVQHPIYSCL------KQVIGITS 331
Fly 332 YGLVCGVQGL--PSVYTKVHLYTDWIENIV 359 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4927 | NP_001033953.1 | Tryp_SPc | 105..358 | CDD:238113 | 50/222 (23%) |
| Tryp_SPc | 105..355 | CDD:214473 | 48/219 (22%) | ||
| CG1632 | NP_001245577.1 | SEA | 232..327 | CDD:279699 | |
| CRD_FZ | 384..502 | CDD:143549 | |||
| PRKCSH-like | <503..>582 | CDD:193472 | |||
| LDLa | 536..571 | CDD:238060 | |||
| Tryp_SPc | 708..>809 | CDD:304450 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR24258 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||