DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4927 and CG30375

Sequence 1:NP_001033953.1 Gene:CG4927 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_724665.1 Gene:CG30375 FlyBaseID:FBgn0050375 Length:398 Species:Drosophila melanogaster

Alignment Length:371 Identity:103/372 (28%)
Similarity:149/372 (40%) Gaps:84/372 (23%)


  Fly    29 CK-ELSATDCPSIFFNLH-----LIRNFVKYCDK------SNHIVCCLLPNNMQPQSQQFSANIG 81
            |: ||....|.|.|..:.     ..|:..:||..      ||.........:..||:||.|    
  Fly    69 CRFELFPDTCGSEFLFISRDGDLQFRDGERYCRMGQVNRISNFQTMAFAYYSSSPQTQQRS---- 129

  Fly    82 LRRFEKECRRFNEIRTSC----RTTPF---------IVGGAKAAGREFPFMALLGQRGKNSSQID 133
                          |.:|    |..|.         |..|.:|...|||  :::|.|.. ||.:.
  Fly   130 --------------RLNCQAVARPAPCDCGWSFPNRIANGVEAGKHEFP--SMVGLRDL-SSNLP 177

  Fly   134 WDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLGELDYNSTTDDAQPQDFRVLNY 198
            ..||..|:..::::|||||     |..|.:     ..:.:..:||.|.::..:......:|:.|.
  Fly   178 IFCGGSIVSERYIMTAAHC-----TARQPV-----ASRLLALVGEHDLSTGAESIYAAQYRIQNI 232

  Fly   199 VVHPAYGEDDDTGSRK-NDIAVVELEMEATFSEYVAPACLPL----DGGNEQLQVAAAGWGATSE 258
            :.||.|.|   |.|.. ||||:::......:|..|||.|||:    :..|.| .|...|||....
  Fly   233 INHPGYME---TASGNINDIALLQTATPIEWSRGVAPICLPIRQAENSFNYQ-NVDIMGWGTLGF 293

  Fly   259 SGHASSHLLKVSLDRYDVAECSQRLEHKIDVRTQLC---AGSRSTSADTCYGDSGGPVFVQHPIY 320
            :...|:.|.|.:|...|.|.|..|....| ..:.||   ||.|  ..|:|..||||||.      
  Fly   294 AASKSNTLQKATLLTMDNAVCRSRFNSSI-TPSHLCTYDAGGR--GQDSCQYDSGGPVI------ 349

  Fly   321 SCLKQ-----VIGITSYGLVCGVQGLPSVYTKVHLYTDWIENIVWG 361
              |:|     .:|:.|||..||......|.|:|..:.:|:...:.|
  Fly   350 --LRQRERMFQLGVISYGRACGQPFGIGVNTRVTSHLNWLWRYIGG 393

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 82/266 (31%)
Tryp_SPc 105..355 CDD:214473 82/263 (31%)
CG30375NP_724665.1 CUB 38..>100 CDD:294042 8/31 (26%)
Tryp_SPc 151..386 CDD:214473 81/263 (31%)
Tryp_SPc 152..387 CDD:238113 82/263 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47814
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.