DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4927 and Habp2

Sequence 1:NP_001033953.1 Gene:CG4927 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001316864.1 Gene:Habp2 MGIID:1196378 Length:554 Species:Mus musculus

Alignment Length:419 Identity:118/420 (28%)
Similarity:170/420 (40%) Gaps:122/420 (29%)


  Fly    20 EFCDNGTGEC---------KELSAT--DCPSIFFNLHLI-----------------------RN- 49
            :||:.|..:|         .::|.|  ..|.:::|.||:                       || 
Mouse   179 KFCEIGPDDCYVGDGYSYRGKVSKTVNQNPCLYWNSHLLLQETYNMFMEDAETHGIAEHNFCRNP 243

  Fly    50 --------FVK---------YCDKSNHIVCCLLPNNMQPQSQQFSANIGLRRFEKECRRFNEIRT 97
                    |||         |||    :..|.:|:...|........:.|..||           
Mouse   244 DGDHKPWCFVKVNSEKVKWEYCD----VTVCPVPDTPNPVESLLEPVMELPGFE----------- 293

  Fly    98 SCRTTPF-------IVGGAKAAGREFPFMALLGQRGKNSSQIDWD------CGAIIIHPKFVLTA 149
            ||..|..       |.||.|:...:.|:...|    :.|..:...      ||..:|||.:||||
Mouse   294 SCGKTEVAEHAVKRIYGGFKSTAGKHPWQVSL----QTSLPLTTSMPQGHFCGGALIHPCWVLTA 354

  Fly   150 AHCLETSETKEQRLDPNYDGPKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRK 214
            |||.:.: ||..:           |.||:.|...|  ::..|.|||...:.:..|.|.|:.  ..
Mouse   355 AHCTDIN-TKHLK-----------VVLGDQDLKKT--ESHEQTFRVEKILKYSQYNERDEI--PH 403

  Fly   215 NDIAVVELEME----ATFSEYVAPACLPLDGGNEQLQVAAAGWGATSESGHASSHLL--KVSLDR 273
            ||||:::|:..    |..|.||...|||.|......:...:|||.| |:|..|..||  ||.|..
Mouse   404 NDIALLKLKPVGGHCALESRYVKTVCLPSDPFPSGTECHISGWGVT-ETGEGSRQLLDAKVKLIA 467

  Fly   274 YDVAECSQRLEHKIDVRTQLCAGS-RSTSADTCYGDSGGPVFVQHPIYSCLKQ----VIGITSYG 333
            ..:....|..:|.|| .:.:|||: :...:|||.||||||:       :|.|.    |.||.|:|
Mouse   468 NPLCNSRQLYDHTID-DSMICAGNLQKPGSDTCQGDSGGPL-------TCEKDGTYYVYGIVSWG 524

  Fly   334 LVCGVQGLPSVYTKVHLYTDWIENIVWGE 362
            ..||.:  |.|||:|..:.:||:..:..|
Mouse   525 QECGKK--PGVYTQVTKFLNWIKTTMHRE 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 90/270 (33%)
Tryp_SPc 105..355 CDD:214473 89/267 (33%)
Habp2NP_001316864.1 EGF_CA 67..103 CDD:238011
EGF_CA 150..182 CDD:238011 2/3 (67%)
KR 187..271 CDD:238056 16/88 (18%)
Tryp_SPc 307..544 CDD:214473 89/268 (33%)
Tryp_SPc 308..547 CDD:238113 90/270 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4734
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.