DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4927 and svh-1

Sequence 1:NP_001033953.1 Gene:CG4927 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans

Alignment Length:369 Identity:100/370 (27%)
Similarity:153/370 (41%) Gaps:81/370 (22%)


  Fly    10 ILAVICSILSEFCDNGTGECKELSATDCPSIFFNLHLIRNFVKYCDKSNHI-VCCLLPNNMQPQS 73
            ||:...:|.|.:..|...:|....::.|                   :.|. :.|:..|.|...|
 Worm   646 ILSTNATISSGYNVNCDVDCSIRRSSSC-------------------TRHARISCISQNGMSSAS 691

  Fly    74 QQFSANIGLRRFEKECRRFNEIRTSCRTTPFIVGGAKAAGREFPFMALLGQRGKNSSQIDWDCGA 138
            |     .|||..|...|...:.|.:     .:|||.:.....||:.|.|    :|.:.....|||
 Worm   692 Q-----CGLRYVEVNARDAAKSRIA-----RVVGGFETVPGAFPWTAAL----RNKATKAHHCGA 742

  Fly   139 IIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPA 203
            .|:....::|||||.|    :::|:.      .|.|.:|:.|.|.|  |...|.|.:.....:|.
 Worm   743 SILDKTHLITAAHCFE----EDERVS------SYEVVVGDWDNNQT--DGNEQIFYLQRIHFYPL 795

  Fly   204 YGEDDDTGSRKNDIAVVELEMEA-TFSEYVAPACLP-----LDGGNEQLQVAAAGWGATSESGHA 262
            |   .|..|  :|||::|:.... .|:||..|.|||     ...|.   |...:|||:   .|..
 Worm   796 Y---KDIFS--HDIAILEIPYPGIEFNEYAQPICLPSKDFVYTPGR---QCVVSGWGS---MGLR 849

  Fly   263 SSHLLKVSL----DRYDVAECSQRLEHKIDVRTQLCAGSRSTSADTCYGDSGGPVFVQHPIYSCL 323
            .:..|:.:|    :|:|....||  .:....|:..|||......|:|.||||||       ::|.
 Worm   850 YAERLQAALIPIINRFDCVNSSQ--IYSSMSRSAFCAGYLEGGIDSCQGDSGGP-------FACR 905

  Fly   324 KQ-----VIGITSYGLVCGVQGLPSVYTKVHLYTDWIENIVWGE 362
            ::     :.|:.|:|..|..:..|.:||.|..|..||..|:.|:
 Worm   906 REDGAFVLAGVISWGDGCAQKKQPGIYTMVAPYLSWISAIINGQ 949

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 79/268 (29%)
Tryp_SPc 105..355 CDD:214473 78/265 (29%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:295335 8/54 (15%)
Tryp_SPc 712..942 CDD:214473 78/266 (29%)
Tryp_SPc 713..945 CDD:238113 79/268 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24258
Phylome 1 0.910 0.625 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.