DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4945 and si:ch211-183d21.3

Sequence 1:NP_788382.1 Gene:CG4945 FlyBaseID:FBgn0034137 Length:577 Species:Drosophila melanogaster
Sequence 2:XP_688256.4 Gene:si:ch211-183d21.3 ZFINID:ZDB-GENE-091118-114 Length:400 Species:Danio rerio

Alignment Length:376 Identity:116/377 (31%)
Similarity:179/377 (47%) Gaps:21/377 (6%)


  Fly     1 MSKKPRGNIHKIREFELEKIQLVDEFDIIQIVGEGWFGKILLVEHRGSQTEMVLKAVPKPYVTLR 65
            |...|..::..:....|...::..:|::|..:|:|.:||:.||.||...|::.||.|.|....||
Zfish    28 MGGAPVEDMQALSITSLSASEVEQQFELISPLGKGTYGKVDLVVHRTQGTKLALKYVSKNKTKLR 92

  Fly    66 DFYREFHYGLHLGVHRHIVTTYDVAFETAGFYVFTQEYAPLGDLTSNV-TDSGVGEVYSKRVAKQ 129
            .|.||:.....||....|:...:|.|||...|||.|||||.|||...: ..:|:.|...||..:|
Zfish    93 SFLREYSLNAALGCSPFIIKVLNVLFETEDSYVFGQEYAPAGDLFDIIPPQAGLPEEMVKRCVQQ 157

  Fly   130 LASAIDYMHSKDIVHRDIKLDNVLIYRSDFQRIKLCDFGESFPTGSTVERRNEWLPYSPPEVLEI 194
            |..|:|:||||.:||||:|.:|||::..:.:|:||.|.|.:..:||.::|.:..:||:..||.:.
Zfish   158 LGLALDFMHSKSLVHRDVKPENVLLFDRECRRVKLADLGMTRRSGSRIKRISGTIPYTAAEVCQA 222

  Fly   195 KPEGSYKADPSHDVWQFGIVIFVCLTGCLPWQKAASDDPRYVRYLAWQGGLMMMPLRRTPRLFKL 259
            ..........:.|||.||:::|..|||..||:.|..:|..:..:..||.|  ..|....|..::.
Zfish   223 SVSEGIIVATTQDVWAFGVLLFCMLTGNFPWEAALPNDAFFAEFQRWQRG--AFPPGSVPSQWRR 285

  Fly   260 LTSNAQRMFKRFFARISNRPKSLADVTKFLDDRWLAKTAQKEMAEYETDELCPSMYSFHSSPDEK 324
            .:.:|.|||.|..|....|...:.:|..||  ::......:..|...|.....:..|.|...|..
Zfish   286 FSDDALRMFGRLLALEPERRCGVKEVFYFL--KYDLLNHHRRRASCRTSRGGATHCSAHRHADPS 348

  Fly   325 NKLLYTLADCGIETNVDRQQKKNRIKDWIESSIITEEDEEENEETNSASPS 375
            ..   :...|...|.:.|             ||::|......|.:.|.||:
Zfish   349 PP---SGTSCLRPTPLKR-------------SILSELHSSREESSKSPSPN 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4945NP_788382.1 SPS1 25..358 CDD:223589 108/334 (32%)
STKc_SBK1 32..293 CDD:270889 96/262 (37%)
si:ch211-183d21.3XP_688256.4 S_TKc 53..322 CDD:214567 98/273 (36%)
STKc_SBK1 59..319 CDD:270889 96/264 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C99438
eggNOG 1 0.900 E1_KOG1345
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 186 1.000 Inparanoid score I3853
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1221624at2759
OrthoFinder 1 1.000 FOG0000425
OrthoInspector 1 1.000 T128588
orthoMCL 1 0.900 OOG5_133032
Panther 1 1.100 LDO PTHR24359
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4887
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.