DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4945 and unm_sa1261

Sequence 1:NP_788382.1 Gene:CG4945 FlyBaseID:FBgn0034137 Length:577 Species:Drosophila melanogaster
Sequence 2:XP_684216.2 Gene:unm_sa1261 ZFINID:ZDB-GENE-120411-10 Length:409 Species:Danio rerio

Alignment Length:417 Identity:132/418 (32%)
Similarity:200/418 (48%) Gaps:54/418 (13%)


  Fly     1 MSKKP---RGNIHKIREFE------LEKIQLVDEFDIIQIVGEGWFGKILLVEHRGSQTEMVLKA 56
            ||..|   |.:...:.|.:      |||:.....:::|:.:|:|.:||:.||.|:...|:|.||.
Zfish     1 MSSSPLVSRSSNDILEELQLITAKNLEKLDFNKYYEVIRELGKGTYGKVDLVVHKIRGTKMALKF 65

  Fly    57 VPKPYVTLRDFYREFHYGLHLGVHRHIVTTYDVAFETAGFYVFTQEYAPLGDLTSNVTDS-GVGE 120
            :.|....|:.|.||:...|:|.....|:..|.:||||..:|:|.|||||.|||...:... |:.|
Zfish    66 LRKKTTKLKSFLREYSISLYLSPCHFIINMYGIAFETDEYYIFAQEYAPAGDLFDIIPPQVGLPE 130

  Fly   121 VYSKRVAKQLASAIDYMHSKDIVHRDIKLDNVLIYRSDFQRIKLCDFGESFPTGSTVERRNEWLP 185
            ..:||...|:|.|:||:|.|.:||||||.:||||:..:.:::||.|||.:...||.|:|.:..:|
Zfish   131 NVAKRCVHQVAIALDYLHCKKLVHRDIKPENVLIFDKECRKVKLSDFGMTRRAGSPVKRVSGTIP 195

  Fly   186 YSPPEVLEIKPEGSYKADPSHDVWQFGIVIFVCLTGCLPWQKAASDDPRYVRYLAWQGGLMMMPL 250
            |:.||:.:...:.....|.|.|||.||:::|..|||..||:||...|..|..::.||     ...
Zfish   196 YTAPELCDPGRQEGLCVDYSTDVWAFGVLLFCMLTGNFPWEKALPSDAFYEEFVRWQ-----QRR 255

  Fly   251 RRT---PRLFKLLTSNAQRMFKRFFARISNRPKSLADVTKFLDDRWLAKTAQKEMAEYETDELCP 312
            ||:   |..::..|..|..||:...:...:|..|:.:|..:.:..|:..|....           
Zfish   256 RRSSSVPSQWRRFTEEALCMFRCLLSIEQDRRCSVKEVFSYFNHCWMLDTENGN----------- 309

  Fly   313 SMYSFHSSPDEKNKLLYTLADCGIETNVDRQQKKNRIKDWIESSIITEEDEEENEETNSASPSSS 377
               :.|.|....|.        |...| .||.:       :.||...|:|..:.....|.||...
Zfish   310 ---TTHISSSNGNS--------GTVMN-GRQAE-------LSSSSSEEDDLVDRLNKQSLSPVCG 355

  Fly   378 VSR-----EPLPGHISSLRKPTSPAES 399
            |::     ||:..|.|| ....|||.|
Zfish   356 VTKGGIIMEPVTTHYSS-TSTNSPASS 381

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4945NP_788382.1 SPS1 25..358 CDD:223589 109/337 (32%)
STKc_SBK1 32..293 CDD:270889 97/265 (37%)
unm_sa1261XP_684216.2 S_TKc 35..302 CDD:214567 99/272 (36%)
STKc_SBK1 41..301 CDD:270889 97/265 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C106368
eggNOG 1 0.900 E1_KOG1345
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 186 1.000 Inparanoid score I3853
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1221624at2759
OrthoFinder 1 1.000 FOG0000425
OrthoInspector 1 1.000 T128588
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24359
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4887
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.