DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4945 and ppk24

Sequence 1:NP_788382.1 Gene:CG4945 FlyBaseID:FBgn0034137 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_596341.1 Gene:ppk24 PomBaseID:SPBC21.07c Length:461 Species:Schizosaccharomyces pombe

Alignment Length:365 Identity:91/366 (25%)
Similarity:139/366 (38%) Gaps:94/366 (26%)


  Fly    17 LEKIQLVDEFDIIQIVGEGWFGKILLVEHRGSQTEMVLKAVPKPY-----------VTLRDFYRE 70
            |.:|:...:|..::.:.:|....|.:|.||...|:..:....|.|           .|:..|.||
pombe   111 LPEIRFRLDFQHLKSIAKGATSTIKVVTHRDKITDAKIYYAAKVYRKTKTSHKKRLNTMVYFLRE 175

  Fly    71 FHYGLHLGVHRHI-------VTTYDVAFETAGFYVFTQEYAPLGDLTSNVTDSGVGEVYSKRVAK 128
            :.....|. |.:|       ||...|..::||| ...|||.|.|||...:.:..:.........|
pombe   176 WSIQPKLD-HPNILKVICPCVTLTSVFNKSAGF-CLVQEYCPQGDLFKQIEEKVLTLEDKCCYLK 238

  Fly   129 QLASAIDYMHSKDIVHRDIKLDNVLIYRSDFQRIKLCDFGESFPTGSTVERRNE----------W 183
            |:..|:.|:.|:.|.|||:|.:|:||.|...  :||.|||.|...|:..:  ||          .
pombe   239 QILQAVAYLQSQRIAHRDLKPENILIGRDGL--LKLTDFGTSEIVGNPGD--NESIRFVSGAVGS 299

  Fly   184 LPYSPPEVLEIKPEGSYKADPSHDVWQFGIVIFVCLTGCLPWQKAASDDPRYVRYL--------- 239
            |.|..||...   |..| .....|.|..||::.|..||..|::.:...|..|.:|:         
pombe   300 LAYLAPEAFH---ENEY-CGLLADRWSCGILLKVLFTGYFPFKTSVKTDLYYSKYMSILTDTCGI 360

  Fly   240 ------AWQGGLM-----MMPLRRTPR-----LFKLLTSNAQRMFKRFFARISNRPKSLADVTKF 288
                  ::|..::     :.|||..|.     :..||..::|           |||    .:...
pombe   361 SSTDESSFQTEVIKQIPTLQPLRYIPEGAKKIILSLLNPDSQ-----------NRP----SLDSI 410

  Fly   289 LDDRWLAKTAQKEMAEYETDELCPSMYSFHSSPDEKNKLL 328
            |...|:.|.           :.|.:.     |.|.:||.|
pombe   411 LGTAWVRKL-----------DCCSNF-----STDHENKSL 434

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4945NP_788382.1 SPS1 25..358 CDD:223589 89/358 (25%)
STKc_SBK1 32..293 CDD:270889 80/314 (25%)
ppk24NP_596341.1 S_TKc 120..416 CDD:214567 82/321 (26%)
STKc_HAL4_like 126..416 CDD:270896 81/315 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.