DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4945 and Y39G8B.5

Sequence 1:NP_788382.1 Gene:CG4945 FlyBaseID:FBgn0034137 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_496929.2 Gene:Y39G8B.5 WormBaseID:WBGene00012726 Length:726 Species:Caenorhabditis elegans

Alignment Length:439 Identity:87/440 (20%)
Similarity:142/440 (32%) Gaps:119/440 (27%)


  Fly   133 AIDYMHSKDIVHRDIKLDNVLIY-------RSDFQRIKLCDFG--ESFPTGSTVERRN------- 181
            |:..:...:|.|||||..|:|::       |......||||.|  ::....|:.|..:       
 Worm   140 ALSALREHNIAHRDIKHMNILLFPGSPTRGRRSTHLFKLCDMGCSKAISENSSQELNSIAGTKTF 204

  Fly   182 EWLPYSPPEVLEIKPEGSYKADPSHDVWQFGIVIFVCLTGCLPWQKAASDDPRYVRYLAWQGGLM 246
            .:..:.||.....|.:.:|..:.. |:|..|..::.|.||..|::...:|...|        .:.
 Worm   205 LYPDHIPPNGHNWKTKSAYTPEQC-DLWSLGCTLYFCATGEFPFESTRADANLY--------HMA 260

  Fly   247 MMPLRRTPRLFK---LLTSNAQRMFKRF-FARISNRPKSLADVTKFLDDRWLAKTAQKEMAEYET 307
            .:.|.|.|....   :...|.....|.| |..::..|   |:.|::  .:||..|.         
 Worm   261 AVDLTRNPNAVAVNLVQVENPVTKEKVFNFEPVTELP---AEFTRY--PKWLVCTM--------- 311

  Fly   308 DELCPSMYSFHSSPDEKNKLLYTLADCGIETNVDRQQKKNRIKDWIESSIITEEDEEENEETNSA 372
              .|.....||....|     |.....|    |.|..|:.......:.||:...|          
 Worm   312 --TCLLRNFFHEPSIE-----YYAKVAG----VMRNSKRRTFASVDQMSIVEHTD---------- 355

  Fly   373 SPSSSVSREPLPGHISSLRKPTSPAESAKEINSTLKDATQKHF-DPRTGALQQGPSEM------- 429
              .|::....||.....|..|       :.|:..|...|..|: |.:..::...|.::       
 Worm   356 --MSNILESSLPSISECLGYP-------EGIDIVLLANTSTHYLDSKQKSVDGLPDDLYLVLPQT 411

  Fly   430 GQVAMAYSKSASPASN------------------YSTTASTLNNADSLMTLGSRQDLLASNLTMY 476
            .||.|......:...|                  |. ..|.|...|..:.|..|...:.|  |.:
 Worm   412 SQVEMRTLLKRNIKFNELECMTDTKLIEIRIKKCYE-GLSMLTEVDEYLDLFDRVSAILS--TQF 473

  Fly   477 TSMETELNRLGEADPRLNQRTQSNNPLLTTFDV---------NTNPAAK 516
            :.:..||::.        :|.|:.:......|:         ..||.||
 Worm   474 SLLVQELSQF--------ERVQTTSRFAVYVDMASVPMMLFDEANPEAK 514

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4945NP_788382.1 SPS1 25..358 CDD:223589 54/245 (22%)
STKc_SBK1 32..293 CDD:270889 40/180 (22%)
Y39G8B.5NP_496929.2 PKc_like 25..263 CDD:304357 30/132 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C108175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24359
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.