DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4945 and ikke-1

Sequence 1:NP_788382.1 Gene:CG4945 FlyBaseID:FBgn0034137 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_871627.1 Gene:ikke-1 WormBaseID:WBGene00011299 Length:820 Species:Caenorhabditis elegans

Alignment Length:595 Identity:115/596 (19%)
Similarity:177/596 (30%) Gaps:234/596 (39%)


  Fly   133 AIDYMHSKDIVHRDIKLDNVLIY-------RSDFQRIKLCDFG--ESFPTGSTVERR------NE 182
            |:..:...:|.|||||..|:|::       |......||||.|  :|....|:.|.|      |.
 Worm   136 ALSALREHNIAHRDIKHMNILLFPGTPTRGRRSTHLFKLCDMGCSKSLSENSSHEMRTLVGTPNL 200

  Fly   183 WLPYSPPEVLE---------IKPEGSYKADPSHDVWQFGIVIFVCLTGCLPWQK----------- 227
            ..|:...|:::         .|.:.:|.::.. |:|..|..::.|.||..|::.           
 Worm   201 LHPFLAHEMVDPLMAQNRHNWKTKSAYTSEQC-DLWALGCTLYFCATGKFPFEHERNNKSLYHKA 264

  Fly   228 --AASDDPRYVRYLAWQGG---------LMMMPLRRTPRLF----KLLTSNAQRMFKRFFARISN 277
              |.:.:|..:..:..|.|         ....|:...|..|    |.|.|....:.:.||    :
 Worm   265 VVALTQNPDAIAMVLVQKGRDPGRRTDIFEFQPVTELPAKFTRYPKWLVSTMTCLLRSFF----H 325

  Fly   278 RPK-----SLADVTKFLDDRWLAKTAQKEMAEYE------------------------TDELCPS 313
            .|.     .:||..:....|..:...|..:.|:.                        ||.|..|
 Worm   326 EPSIEYYAKVADAMRNSKRRTFSSVDQMSIVEHTDMSNVPHLGFSIPSISKCLGYPEGTDILLLS 390

  Fly   314 MYSFHSSPDEKNKLLYTLAD-------------------CGIETN-----VDRQQKKNRIKDWIE 354
            ..|.|.. |.|.|.:..|.|                   ..||.:     .||:..:.|||...|
 Worm   391 NTSTHYL-DSKQKSVDGLPDDLYLVVPQTSHVDMRKILARNIEFHEFDDMTDRKLSEIRIKKCYE 454

  Fly   355 S-SIITEEDE--------------------------------------------------EENEE 368
            . |::||.||                                                  |.|.|
 Worm   455 GLSMLTEIDEYLALFDRVSTILSTQFSLLVQELSQFERVQTASRFAVYVDMASVPLMLFDEANPE 519

  Fly   369 TNSAS----PSSSVSREPLPGHISSLRKPTSPAES-AKEINSTLKDATQKHFDPRTGALQQGPSE 428
            |...|    ..:..:||.|..|    .|.:...|: ||:::...:|...:..|      ..|..|
 Worm   520 TKMISDQCIQQAKRAREELERH----AKVSMDIEACAKQLSKDAEDLRLEDMD------LPGICE 574

  Fly   429 MGQVAMAYSKSA----------------------------SP-ASNYSTTASTLNNADSLMTLGS 464
            ..:..:.|.|.|                            || ..|.|.....:|.|.||..|.|
 Worm   575 EIESYVFYDKQAILSTQKYSQELVELCLKRRNNIMEQIFNSPDRINKSKLNKAMNLAASLSQLRS 639

  Fly   465 R----QDLLA--------------------------SNLTMYTSMETELNRLGEADPRLNQRTQS 499
            .    ||:::                          |..||..||........|:..|:.:.|:|
 Worm   640 NYRKLQDMISECVDLLEKPFQEMKDTVNRYLQAQGCSRNTMQKSMHLLRPEFHESQIRIKKTTKS 704

  Fly   500 NNPLLTTFDV 509
            ...|:...::
 Worm   705 CRKLIDQLNI 714

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4945NP_788382.1 SPS1 25..358 CDD:223589 69/329 (21%)
STKc_SBK1 32..293 CDD:270889 47/215 (22%)
ikke-1NP_871627.1 SPS1 25..404 CDD:223589 58/274 (21%)
PKc_like 27..275 CDD:304357 33/140 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C108202
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24359
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.