DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4945 and LOC100489561

Sequence 1:NP_788382.1 Gene:CG4945 FlyBaseID:FBgn0034137 Length:577 Species:Drosophila melanogaster
Sequence 2:XP_012826828.1 Gene:LOC100489561 ID: Length:361 Species:Xenopus tropicalis

Alignment Length:449 Identity:122/450 (27%)
Similarity:186/450 (41%) Gaps:95/450 (21%)


  Fly    21 QLVDEFDIIQIVGEGWFGKILLVEHRGSQTEMVLKAVPKPYVTLRDFYREFHYGLHLGVHRHIVT 85
            |:.|.:.:|:.:|:|.|..:||...|.|...:.||.|.|.......|..|.:..:.|..:..|:.
 Frog     6 QIGDHYHVIKKLGQGTFSHVLLARERISGHSVALKFVRKDRTRQAAFLHELNISISLSDYPGIIK 70

  Fly    86 TYDVAFETAGFYVFTQEYAPLGDLTSNV-TDSGVGEVYSKRVAKQLASAIDYMHSKDIVHRDIKL 149
            ||....||..:::||||.||.|.|.|.: ::.|:.|...||.|.|:.:|:||:|.:.:||||:|.
 Frog    71 TYPTYIETLDYFIFTQELAPAGTLHSIIESEVGIPEEVVKRCAVQITAALDYIHGRGLVHRDLKP 135

  Fly   150 DNVLIYRSDFQRIKLCDFGESFPTGSTVERRNEWLPYSPPEVLEIKPEGSYKADPSHDVWQFGIV 214
            ||||:...:...|||||||.:...|..|...:..:||.|||:..:||.......||.|:|..||:
 Frog   136 DNVLLMDKECYHIKLCDFGFTQNVGFLVPSMSHIIPYMPPELCSLKPNHLLVLGPSMDIWSLGIL 200

  Fly   215 IFVCLTGCLPWQKAASDDPRYVRYLAWQGGLMMMPLRRTPRLFKLLTSNAQRMFKRFFARISNRP 279
            :||.|||..||::|...:.:|..::.|:.....:|   ||.|:...|..|..||....:.|....
 Frog   201 LFVALTGYFPWEEALGHNQKYQLFVHWKNNRNYVP---TPILWDRFTQEALDMFLMLLSEIPCAR 262

  Fly   280 KSLADVTKFLDDRWLAKTAQKEMAEYETDELCPSMYSFHSSPDEKNKLLYTLADCGIETNVDRQQ 344
            .....|.:||...|:||.        .:|.|.                        :|.::    
 Frog   263 HPPDTVLQFLHFPWMAKN--------NSDGLV------------------------VEGDL---- 291

  Fly   345 KKNRIKDWIESSIITEEDEEENEETNSASPSSSVSREPLPGHISSLRKPTSPAESAKEINSTLKD 409
                       :||..||..|               .|:..:|...::.....|:..:|.....|
 Frog   292 -----------NIIILEDNNE---------------LPVIEYIIQEQEQVIVVENTDDIEFMYVD 330

  Fly   410 ATQKHFDPRTGALQQGPSEMGQVAMAYSKSASPASNYSTTASTLNNADSLMTLGSRQDL 468
            ..|.|.||.           ..|.|..|::.|                  ::|||..|:
 Frog   331 NAQMHLDPN-----------NPVIMLLSENTS------------------LSLGSEIDI 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4945NP_788382.1 SPS1 25..358 CDD:223589 99/334 (30%)
STKc_SBK1 32..293 CDD:270889 91/262 (35%)
LOC100489561XP_012826828.1 S_TKc 11..277 CDD:214567 93/269 (35%)
STKc_SBK1 17..276 CDD:270889 91/262 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1221624at2759
OrthoFinder 1 1.000 FOG0000425
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.