DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4945 and si:dkey-8e10.3

Sequence 1:NP_788382.1 Gene:CG4945 FlyBaseID:FBgn0034137 Length:577 Species:Drosophila melanogaster
Sequence 2:XP_001341750.1 Gene:si:dkey-8e10.3 ZFINID:ZDB-GENE-081104-442 Length:338 Species:Danio rerio

Alignment Length:313 Identity:102/314 (32%)
Similarity:161/314 (51%) Gaps:18/314 (6%)


  Fly    19 KIQLVDEFDIIQIVGEGWFGKILLVEHRGSQTEMVLKAVPKPYVTLRDFYREFHYGLHLGVHRHI 83
            |:::.:.|:||:.:|.|.:|::|||.||...|.|.||.:||....|:.|.||:...|||..|..|
Zfish    27 KLEIPEHFNIIKEIGRGKYGRVLLVTHRCKGTPMALKVLPKASTKLQGFLREYCISLHLSCHPCI 91

  Fly    84 VTTYDVAFETAGFYVFTQEYAPLGDLTSNVTDS-GVGEVYSKRVAKQLASAIDYMHSKDIVHRDI 147
            |..:.:||::...|.|.||.....||.:.:... |:.|...||.|.|::.|::::|.:.:|||||
Zfish    92 VGLFGIAFQSNEHYGFAQELVTGRDLFAIIQPRVGIPECAVKRCAVQISCALEFIHQRGLVHRDI 156

  Fly   148 KLDNVLIYRSDFQRIKLCDFGESFPTGSTVERRNEWLPYSPPEVLEIKPEGSYK--------ADP 204
            |.:|||:..:..:|:||.|||.:...|:.:...:..|||..||:.::..|...|        .:|
Zfish   157 KPENVLLLDNHCRRVKLADFGLTQRQGTFIRFISGTLPYMAPELCKMVLEDGQKEPKVPPLRVEP 221

  Fly   205 SHDVWQFGIVIFVCLTGCLPWQKAASDDPRYVRYLAWQGGLMMMPLRRTPRLFKLLTSNAQRMFK 269
            |.|.|.|.:::|..|||..||::....|..|..:..|:..:...|:   |..:|..|....:|||
Zfish   222 SLDTWAFAVLLFCILTGFFPWERCNDSDDFYEEFADWRQSVKKSPV---PSQWKRFTPVCMQMFK 283

  Fly   270 RFFARISNRPKSLADVTKFLDDRWL-AKTAQKEMAE-----YETDELCPSMYS 316
            |.....||:..|:.:|..::...|: .|.|...:.|     ..|...|.|.||
Zfish   284 RMLTIESNKRCSITEVKGYVGKDWVREKDANGWVGENGDICTSTPSPCRSSYS 336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4945NP_788382.1 SPS1 25..358 CDD:223589 101/308 (33%)
STKc_SBK1 32..293 CDD:270889 89/270 (33%)
si:dkey-8e10.3XP_001341750.1 S_TKc 34..300 CDD:214567 92/269 (34%)
STKc_SBK1 40..307 CDD:270889 89/270 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1345
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 186 1.000 Inparanoid score I3853
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1221624at2759
OrthoFinder 1 1.000 FOG0000425
OrthoInspector 1 1.000 T128588
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.