DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syn2 and SNTG2

DIOPT Version :10

Sequence 1:NP_788381.1 Gene:Syn2 / 36848 FlyBaseID:FBgn0034135 Length:519 Species:Drosophila melanogaster
Sequence 2:XP_016859850.1 Gene:SNTG2 / 54221 HGNCID:13741 Length:540 Species:Homo sapiens


Alignment Length:61 Identity:16/61 - (26%)
Similarity:23/61 - (37%) Gaps:26/61 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 QQHCR---------------AKEELQF---------TAETYRCYLE-SLRKLKDLNESYRG 87
            ::||:               .|..|:|         ..|...|.|: .|.|| :|:|||.|
Human     2 EEHCKLEHQQVGCTMCQQSMQKSSLEFHKANECQERPVECKFCKLDMQLSKL-ELHESYCG 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syn2NP_788381.1 PDZ_syntrophin-like 77..159 CDD:467262 7/11 (64%)
PH 301..407 CDD:214574
SNTG2XP_016859850.1 PDZ_syntrophin-like 73..155 CDD:467262
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.